SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC03G23960.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC03G23960.1
Domain Number 1 Region: 543-641
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.44e-23
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 25-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-20
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 3 Region: 223-329
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-18
Family B3 DNA binding domain 0.0058
Further Details:      
 
Domain Number 4 Region: 446-528
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.97e-16
Family B3 DNA binding domain 0.0053
Further Details:      
 
Domain Number 5 Region: 766-870
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000112
Family B3 DNA binding domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC03G23960.1
Sequence length 877
Comment pep:novel chromosome:AVCL00000000:3:25571462:25580716:1 gene:OPUNC03G23960 transcript:OPUNC03G23960.1 description:""
Sequence
MAGSNTHRKKSCACCKEYLEHLGGKMRCFLRRMAADSKHSMIMPDRFVSHFGGKIPGTIK
LESPNGILYIVEVIECLNKTVLQCGWEAFVDAHHIKEGESLLFRYIENSRFEVLILDSDD
CEKVFSCAGIRNSSCIQDKIVDPVDSSGSSSNETTQSSRSRNTANLTAMCSSSEKSGEDS
PSGYEFHESVDPLTPSWSDYVLSLRTYLSEAQKERVVAHIQDIQPEITVFVAVMKKCNLQ
SPAPYLVISSCYASVYFPRESATITLQRPSKRKKWYPRFYKRIDKSDHMLRGQWKNFVHD
NCLQEEDICLFVPTKGGRSVTFTVHLLRAAATHYRNGTDVHKIVGSSHDRMNTKMVSQIH
IKQTPGDGDNVSSESNKHGASHESPENEDSDGPSEPPYIISKRRCRLSQLQKKKVEEKVR
AIQSEFPICVAIISKLSGGGGNRKFCGLELSSRYAASYLPDANDQTLVLQCKGMIWQINL
VVHRYTKGKRWFLTTGWRKFAHDNRLRVGDFCLFELKKKKLTMEVHIISNLQHYPETYLE
HLGGKMSCFLRRMTADSMHSMIIPNRFVSHFGGKIPGTIKLESPNGILYVVEVTECMNKT
VLQCGWEAFVDAHHIKVGDSLLFRHIENFCFEVMILDSDGCEKVFSCAGIKNSFCVQDKT
VDPVDTSGSSCDDTAQSSRSERSAGCQRDTSNDRRNSTASLNAVSSSSEESENVSLKSNR
NGVSDESQENEDSEGPADLPYILPCKSKSRLSSLQKKIVEEKVRSIRSEVPIYVAIMNRS
NVGLTSCPCQLELGARYAAAVHLPDRRQTVVLQRMGQRWDTVMQTKIGRSTRRFLVNGWH
RFVRDNRLRVGDICLLELKKHERKLTMTVHTIFSHQS
Download sequence
Identical sequences A0A0E0KGD0
OPUNC03G23960.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]