SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC03G24010.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC03G24010.1
Domain Number 1 Region: 25-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.86e-22
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 243-344
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.97e-19
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 3 Region: 452-560
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.11e-19
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC03G24010.1
Sequence length 563
Comment pep:novel chromosome:AVCL00000000:3:25652872:25658372:1 gene:OPUNC03G24010 transcript:OPUNC03G24010.1 description:""
Sequence
MAGQGSQMKKSCDCCKRYVDHSNGKMKCFHRQMSANFEHSMIIPNKFLEQFGGKISRTVE
LESPKGNVYVVKVSKHMNKTVLRCGWEAFVDAHQIEENDSLLFRHIENSRFAVLILDSDG
CEKVFSCSGKRRASGVQERNADPIDVSSSTHDDTVQSSGGERFARSESGSDSQHSKTAKL
GATCSSGRSGEDAKGSSTSEHESDYDLDDPQIAPMPGYVLSRGTSLSEAQEEKLDMLVQD
IRPEIPLYVTIMKHSNVNSHHASLVIAKHYASAHFPRTSQTITLKWQGKNRKWHPKFYIR
KDQVGYILHGCWIDFVRHNHVNEGDICIFHLKKFTGRKFRATVHLLRETNPHSFGALHIP
KRFESRNGRMRLKMTGDIRVSSTECRRGTMEPSTTNVKKEADNDQCNNNQGKRQEPLNFD
GPVGSSKPYLTADRVSLTEEQVRKVEEIAHSIQSEGPIYVSKMNKSNVGTDGLYIITLGR
QFATRYLPEGEQTLTLLTTGTGKAWQVKMRPRSSDARMFTLGWRDFVRDNRLQTEDICLF
QLMTNNERGLAMTIHIIRHNERS
Download sequence
Identical sequences A0A0E0KGD7
OPUNC03G24010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]