SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC04G18890.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC04G18890.1
Domain Number 1 Region: 2038-2335
Classification Level Classification E-value
Superfamily BEACH domain 1.44e-120
Family BEACH domain 0.0000000111
Further Details:      
 
Domain Number 2 Region: 2457-2526,2561-2676,2715-2762
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.3e-29
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 3 Region: 1912-2020
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-23
Family PreBEACH PH-like domain 0.0012
Further Details:      
 
Domain Number 4 Region: 278-430
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000543
Family Clostridium neurotoxins, the second last domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OPUNC04G18890.1
Sequence length 2788
Comment pep:novel chromosome:AVCL00000000:4:25933740:25953376:-1 gene:OPUNC04G18890 transcript:OPUNC04G18890.1 description:""
Sequence
MAEEPRESLDSSPEPPPRGRDSDEQFSAVPLADEVRTEGREMDPDMSTGTPVAVTPTQSE
PSPPPPRRRRPRPLGVPPDAPQEVVRAVDDAIMVGGGGAVAGVDRLRDMVSEEQGELPHT
VVDVLLGTMGGADGLDEVEDKTGTGAPPSIMFNSRAAVVAAELLPYLPCGEEPSPRTRMA
VGIHATLRSCTRNRAMCSSSGLLPALLDSAEKLLIGMGRTSSWDETPLLHCIQLLGGHSL
SVKDLHSWLGLVNKALGTSWATPLMLALEKAMGSEEARGPAATFEFDGESSGLLGPDNQG
VEAYFHGQFLVVESGGGRGKKASLHFTYAFKPQRWYFVGLEHTNKHGLLGKGDSELRLYV
DGSLHESRPFEFPRISKPLAFCCIGTNPPPTIAGLQRRRRQCPLFAEMGPIYIFREPIGP
ERMSRLASRGGDVLPSFGNGAGLPWRATNDHVKNMAEESFTLNQQIGGCLHLLYHPSLLN
GRLCPDASPSGSAGTHRRPAEVLGLVHVSSRVRPAESLWALAYGGPMALLPLTISNVQMD
SLEPMLGELSIATASLSAPIFRIISLAIQHPGNNEELCRTCAPEILSRVLHYQLQAFRKM
EGGEGEAVTDEELVDAIVSLCQSQRNNHELKVQLFSSLLLDLKMWSSCTYGLQKKLLSSL
ADMIFTESACMRDANALQMLLDSCRRCYWAIREPNSIDNFALTGTKRSLGEINALIDELL
VVVELLLGSTSSTAASDDVRCLIGFVVDCPQPNQVARVLHLIYRLIVQPNISRANMFAQS
FISCGGVDALLVLLQREAKAGNNSILDNSDAVLSENDFLRNDDSDTKAASGEAKSQDDQI
QSVELEQHESILHEEHTELGSTGTNDVPCEILGSSIGRKLSSSENQLLKNLGGINFSITA
DNVRNNVYNVDKGDGIVVGIIHILGALVASGHLKFASSAANPNLPGGLLTTVHEEGNTMS
EDRVSLLLFALQKAFQAAPRRLMTVNVYMALISAAINVSSVDENLNLYDCGHRFEHIQLL
LVLLRSLPYASRSFQSRAIQDLLFLACSHPENRTTMTSISEWPEWILEVLIYNHEDVEAT
IHCAEWLSMVGGSSTGDQRIRREESLPILKRRLLGGLLDFSARELQVQTEVIAAAAAGVA
AEGLSPEEAKTQSENAAHLSVALAENAIVILMLVEDHLRSQGQHFCTSRSLDGAVPSASM
ASSAASRSNSLCRSGNEPMDAGTSRRSSLSTDAGGLPLDVLTSMADSNGQISASVMERLT
SAAAAEPYESVKHAFVSYGSCIADLAESWKYRSRLWYGVGIPSKSDTFGGGGSGWEFWKS
VLEKDSNGTWVDLPLVKKSVAVLQALLLDDSGLGGGLGIGGGSGPGMGVMTALYQLLDSD
QPFLCMLRMTLVSMREDDNGEGDAFTSNISIKDVISEGMGHQAGSMMPLDSNNRSSTRKP
RSALLWSVLGPILNMPINESKRQRVLVASSILYSEVWHAIGRDRSPLRKQYIELILPPFI
AILRRWRPLLAGIHELTSSDGQNPLIADDRALAADALPIEAALSMISPGWAAAFASPPVA
LALAMMAAGASGTEAITPPRNTLNRRDTSVPERKAAPKLQSFTSFQKPIETAPNKHGSTP
KDKAAVKAAALAATRDLERTAKIGSGRGLSAVAMATSGKRRSAGDMERAKRWNTSEAMSA
AWMECLQSVDSKSVSGRDFSALSYKYVAILVSGFALARNLQRVEMERQTQADVLNRHRVS
TGVRAWRHLLHCLTEMDRLYGPFGEPLCTPDRIFWKLDFTESSSRMRRFMKRNHKGSDHL
GAAADYEERKLSNVAQSNECNPEGAEPLLTDTLPSTAPIITAEAMSVDDRNEDNEQLESD
TTQSSVDDRLQQADQQSVKGSVDSRGSGISADRNLVRSTVIAPGYVPSDADERIIVELPS
SMVRPLKVVQGTFQVTSKRINFIIDESASESNMDDHVSTSGQCDQQDKDRSWLISSLHQI
YSRRYLLRRSALELFMVDRSNFFFDFGDMEARKNAYRAIVHSKPPNLNDIFLATQRAEQI
LKRTQLTERWANWEISNFEYLMELNTLAGRSYNDITQYPVFPWIIADYRSEILNLDDPST
YRDLSKDANHREYYLMQPIGALNPERLEKFQERYSTFEDPIIPKFHYGSHYSSAGTVLYY
LFRVEPYTTLSIQLQGGKFDHADRMFSDLSGTWDSVLEDMSDVKELVPEMFYLPEVFTNI
NSIDFGTTQLGGKLDSVNLPPWSEDPVDFVHKHRKALESEHVSAHLHEWIDLIFGFKQRG
KEAVMANNVFFYITYEGTVDIDKITDPVQRQAMQDQIAYFGQTPSQLLTIPHMKRKPLAE
VLHLQTIFRNPSELKSYLLPNPDRCNVPASTMFVSNDSIVVVDVNVPAAHVALHHWQPNT
PDGQGTPFLFHHGRNAANSTGGALMRIFKGSASSGEDYDFPRAIAFAASGIRNSAVVAVT
CDKEIITGGHADGSVKLISPDGAKTIETASGHLAPVTCLALSHDSNYLVTGSRDSTVILW
RIHQAGSLHKKNAPEPPPTTPATPRSPSVSNFTEIRRRRIEGPMHVLRGHLEEVTSCSVS
PDLGLVVSSSNMSGVLLHSLRTGRLIRKLNVAEAHAVCLSSQGVILVWNESKKRLSTFTV
NGLPIATTVLSPFCGRVSCIEISTDGHFALMGTCSSSNYKCEDSTETGDHEPNEPNGKDG
ISKQAETRQSVHVPSVCFVDLHKLKVFHTMELEKGQDVTAIALNKENTNLLLSTADKQLI
VFTDPALSLKVVDQMLRLGWEGDGLLQS
Download sequence
Identical sequences A0A0E0KTQ3
OPUNC04G18890.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]