SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC04G22700.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC04G22700.1
Domain Number 1 Region: 266-514
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000654
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number 2 Region: 1247-1472
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000216
Family Tropomyosin 0.0033
Further Details:      
 
Domain Number 3 Region: 1028-1279
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000229
Family Tropomyosin 0.0042
Further Details:      
 
Domain Number 4 Region: 504-745
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000305
Family Tropomyosin 0.0041
Further Details:      
 
Weak hits

Sequence:  OPUNC04G22700.1
Domain Number - Region: 85-304
Classification Level Classification E-value
Superfamily Tropomyosin 0.00412
Family Tropomyosin 0.0016
Further Details:      
 
Domain Number - Region: 778-876
Classification Level Classification E-value
Superfamily Tropomyosin 0.0137
Family Tropomyosin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OPUNC04G22700.1
Sequence length 1849
Comment pep:novel chromosome:AVCL00000000:4:29442159:29451158:1 gene:OPUNC04G22700 transcript:OPUNC04G22700.1 description:""
Sequence
MEVEQAAEVGEVTAPKLPDKAGDKAQVHDDDKENLVNGNSNLQVKETHNDEDDGTGSDGF
ELIDVKENFDSTKVVEEEKASPMEQGKTAALEEQALTRESAMLNQETKQLEELTRRIEEL
EFEKEKLVKGMTEAENKQNLHYSSLQEAQRSLADKDKELADATQSLKELGSELQSSKERI
QEIEAELAVSADKLHKLEELKDERSLHAAQEAKRASELDKTLETAQLNMKEMETQISYLQ
EEIKGHQDKAIDHQQVEESLRSTLSELKMVQDALELSKSQVDDLEQKLASQDANINNLTE
ELGLHRSSEESLKEKTLKLENELSSAHGELQAKILNLQEIEIKLEEQAKEKQTWEATLEK
QQEQILNLQTELDESKVGNETLQGSIADLNSKLADRDSLLRQAEDEHAKAQMLLSEALSH
KDELEVNLKYINEQHGESRAAAENASQKILELEAQLQILHAAEEALKLQLEEAEARVEVA
EKKGSDLEQLLGESENKLVASSGELKLLEERVQQEAASSAEKEKLLEEAANSVEAYKEKI
NELQASLDSTTSKNQLLEQEVKDLSDKFSEHQEQAHSVHERSLELESLLHTSKSDAEVAH
TRTQDLENELNTANEKFKEVEADLEQYRSKVSQLSDELEAYQTKAASLEAVMESASEKEK
ELMESLGQITEEKKKLELVIAEYEEKTEEHLKEKQSLEERLQSQESKVLALEESLVKLGE
EKESQEITIADLNMQLSNKNDMYTQLESQLSQAGDDHSKTRSLLSEAHLHKEELELNLKS
LSDLHVESKTAAESALQRIAELETQVQELSAAEQSLKSQLTEFESKLSSAEKKSTDLEQE
LKDATEECNSSRLRVDELSGELEEYKEKRTSLEAMLLEAKQKEAELLEKLDQVNEEKEKF
EELSKKATIKHLEAENQVQALQGELESACHKLEEVESDLEALGIRETSVLDKLKSAEEQL
EHKGKALEHATSKKIDLETLYQSLLEDTEMKLQQAGENLTQKETECQELSEKLKAAEEQA
ASYQAKATAAAEEVESVKVELEAFETEISTLETSIEELKTKASNAESRAEQALAESSMMS
ETNQALKEDLDAKLEMLRELQEQFDSTHAEKEEVFTKLSAHEKTIEHLTEVHSRGLELHA
TAESKNAELEAQMREALETIGKKDSEVKDLNERLAALESEIESLTHVNEAMKQEINAKLV
KVDELQEKLSSISYEKEEVAEKLVVHERTIEHLREEHSRGLELQSAAESRTAEIENELHE
VLETVAQKEAEVTDLKEKLVSIETENEKLVGINEALKGELDTKVAMFDELQEQFSSTHAE
KEEAAEKLAVHERTISHLTEVHTRSLELHSAAESKNEEIESKLHEALEMAAQKEAEVKDL
SKKLDALEIELGYYEEQATEAAAAEETHKIKFDEAVHKIKSLEEQLAVTENKVELFHTEK
ENLVTANSKLNEELELHQNKLNELQVALAAAVAEKEGSSEEIHSLRKTLDGMIQRKEELE
SQVSSTVEEHEELKSKYNITLEEKQLLNEKYESAKKELREAIAKLEEQMNIDKSEKELHI
SKLERQITLSELKYMEEIQTMQVETTEKDEALTTKMQEHANLVHEKDVLEQQLLEVRKEL
NDAYRTIANQEEQVSVREIKWDAYKKFSEDQLEAEQQHVAELEVQVSSLKQQLQEVEIHY
KHKEEQVSLREVQWEADQEHSVSELKAQRQYAAELEKQIGALTQQLQLVETQYEQKVTEE
REKLALVNTEVSKLTQKLSKSAEMEKKIEHLEQKLQAKDSVESTSRDFSLDSSTLPSKQR
DRSLAPETTPPNPTQQQELREPSGIMAFKFILGVALLSVLIGVFLGKRY
Download sequence
Identical sequences A0A0E0KV61
OPUNC04G22700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]