SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC05G22370.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC05G22370.1
Domain Number 1 Region: 200-316
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-28
Family B3 DNA binding domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 73-129
Classification Level Classification E-value
Superfamily DNA-binding domain 1.7e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC05G22370.1
Sequence length 399
Comment pep:novel chromosome:AVCL00000000:5:28389298:28390497:1 gene:OPUNC05G22370 transcript:OPUNC05G22370.1 description:""
Sequence
MDSTSCLLDDASSGASTGKKAPAPAAPAATTSKALQRVGSGASAVMDAAEPGAEADSGGE
RRAGGGGGKLPSSKYKGVVPQPNGRWGAQIYERHQRVWLGTFTGEAEAARAYDVAAQRFR
GRDAVTNFRPLAESDPEAAVELRFLASRSKAEVVDMLRKHTYLEELAQNKRAFAAISPPP
PKNPASSPPSSSSAAAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQIPPPTTSVV
ADAGAGAGECKGVLLNFEDAAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVG
FYRAAGKHAQLFIDCKVRAKSTTTAAAAFLSAVAAAAAPAPAVKAIRLFGVDLLTAAAAP
ERRDAAGGAMTKSKRGMDAIAESQPHVVFKKQCIELALT
Download sequence
Identical sequences A0A0E0L5C8
OPUNC05G22370.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]