SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC05G23060.3 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC05G23060.3
Domain Number 1 Region: 313-376
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000403
Family Domains B1 and B5 of PheRS-beta, PheT 0.011
Further Details:      
 
Domain Number 2 Region: 6-98
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000339
Family Domains B1 and B5 of PheRS-beta, PheT 0.0066
Further Details:      
 
Domain Number 3 Region: 223-286
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000162
Family B3/B4 domain of PheRS, PheT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC05G23060.3
Sequence length 420
Comment pep:novel chromosome:AVCL00000000:5:28923534:28930036:1 gene:OPUNC05G23060 transcript:OPUNC05G23060.3 description:""
Sequence
MPTVSVGRDRFFVALGRTYTQEEFEVLCFEFGIELDDVTTEKAIIRKEKHLEDDDGEVDG
DDGEVIYKIEVAANRYDLLCLEGLARALRIFTGTEATPMYKISCIPRDSMLQMYVKPQTS
QIRPFVVCAVLRGVTFDEARYNSFIDLQDKLHQNICRKRTLVAIGTHDLDTLKGPFSYEA
LPPQEINFVPLKQEESFRADKLMEFYKSDMKLKKFLHIIENSPVYPVIYDSNRTVLSLPP
IINGAHSAITLKTRNVFIECTATDLTKAKIVLNTMVTMFSEYCENKFEVEPVEVVSHDGS
KTIYPDLSCYKMEVSLSEVVGPIGISLDETQLQAESCPSKGEPRISVSVPPTRSDILHAR
DLVEDVAIAYGYNNVPKSKPKCMTIGGRQPLNRFSDKLRAEVLELSLVMYLWFCIYLFTK
Download sequence
Identical sequences A0A0E0L5M6
OPUNC05G23060.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]