SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC06G00750.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC06G00750.1
Domain Number 1 Region: 11-567
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.7e-97
Family Acetyl-CoA synthetase-like 0.00000553
Further Details:      
 
Domain Number 2 Region: 792-858,887-1129
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.15e-35
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Domain Number 3 Region: 583-646
Classification Level Classification E-value
Superfamily ACP-like 0.00000544
Family Peptidyl carrier domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OPUNC06G00750.1
Sequence length 1185
Comment pep:novel chromosome:AVCL00000000:6:519546:528361:-1 gene:OPUNC06G00750 transcript:OPUNC06G00750.1 description:""
Sequence
MAAAAAAAKEEEPCCISHAFDRAARRNPNGLAVIHAASSSSSSGSESERRFTCADLLAAV
SSLSRRIAAELRSYTSRHRDESPGCSGRPVEAAAAPRIVGVYASPSVEYIAAVLAVLRCG
EAFLPLDPSWPEERIRWATSSSNAALVVSSRGSGAAHVFASNACSVIRMDDDLWQVFEDE
KGGISREELAWPCKCKKPREFCYVMFTSGSTGKPKGVCGTEKGLLNRFLWMQRWKPLCPD
DLLLFKTSVSFVDHLQEFLSAMLTCTTLVIPPPNDWRANPASLANLIKAYGISRMTLVPS
LMEIILPTLEKNLSWGHNPLKMLIFSGENLSILLWKKVHEILPETTIVNLYGTTEVSGDC
TFFDCTDLPTLLKREELTSVPIGFPISNCEVCIATDFEVADEGEMHVTGACLFAGYLEES
MVNSHTEGNGSSTYYRTGDFARRLKSGEFIFLGRKDRTVKIYGQRFSLQEVESTLKEHPD
VSAAAVTFQNNGSLDFRAYLVLKNSAASEEDCQQRKKYKYSQVIMPSIRSWLVMKLPPAM
IPRFFLPVESLPLTSSGKTDYVKLSSLKCALESCEFETERHTVNPHLQVIKKAFSDALLV
DEVSEFDDFFTLGGNSISAAHVAHRLEIDMRMLYIYSTPSKLLDALFTKHSSLLSSGHEP
HPKKGLDISSSILSSFNLIATSVYDNFPEGKAHINGDGECAHDHISGNYANEVDGQLNRN
VHLSNDRYQTKSLLLDTYSNDRNSVDGSPWILNFCLQKKWSLGRCNRFMHGYEDNLQIED
VCSYVPYNKRGYLQALWNIPLGSCVDASPLLVSNNGMLNIFVGSHSHTFLCIDGCSGSVR
WSVKLEGRVECSAAITGDFSEVTQQQTPLRIYLAFWQPVHGSTSFGQVVVGCYKGKIYFL
DMLTGTQDWTIQTDGENVVAVHFSESQIEVSIFVFRCGSYDHHLYALNYKDRCCTYKISC
GGSIYGSPAIDMTHNMIYVASTSGLVTAISLEVSSFRIVWQYEAGAPIFGSLAIHHQSGK
VICCLVNGLVIALNSHGSVVWKATVGGPIFAGACLSSGLPNQVLIPSRDGRLYSFDTTSG
ALLWKYEVGDPITASAFVDDVLIATSPGSSERFACICTSSGQVHVIRIRADAKQEKVNGS
VCNDLVQGFAAIDLPGDIFSSPLMVGGRIFVGCRDDQLHCLTISP
Download sequence
Identical sequences A0A0E0L6Y7
OPUNC06G00680.1 OPUNC06G00750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]