SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC07G05200.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC07G05200.1
Domain Number 1 Region: 125-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.62e-17
Family B3 DNA binding domain 0.0097
Further Details:      
 
Domain Number 2 Region: 489-590
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000235
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC07G05200.1
Sequence length 930
Comment pep:novel chromosome:AVCL00000000:7:4550767:4555807:1 gene:OPUNC07G05200 transcript:OPUNC07G05200.1 description:""
Sequence
MAAAPPPLADDINRITVTCGSHAPPRTPAASPPVGSVVFYFVDGHAEQFCQFPAPLLEQL
AVPPAPRFFLCTVADVRLRADALTNEAYAAITLDPVGDHDIPRLAPASAVPAAAAAAGGQ
QQQQQQFRSFVKTLMSSDADYRNRFAAPMFVAKDVFPPLVDAKAVQPLVVKDLQGSPMTF
DYGRNGSRVTLVKGWKKFQDDMDFVDGDSVIFMRRGDDELYVGVRRRCTLDKPLNTLRSR
PTTPLQVAVQEVIAAAAHAAAGEQFTVTYRSRQDGDEFVVPREVVEEGLRLRARFTPEME
VEFVWAVEDGAPPSVGPQGMITAMDDTTRMWRALEIGWTGNSKMNKRANFWQVRSVRYGD
RASAAPPPPPSPKRAAAAAAEGSPSSSAQAQAFNVTRDMWLACAAPKSGRLPAVGSLVYY
FPDGHAEQCPSRPPEPLPGRIFLCKVTEVHLCATRNEPMATISLVPVAADDHSLQLQAPA
DPSSTPPQNLVSFVKPLTYTDAVKNRYRFIIPKKDAVMGVLPQLEQNDDVLLRIKDTDGM
EWVFNYTWKEHTRMFRSGWIKFTNANRLVTGDNVVFMRRIDNGEIFMGLRRTLKPELGSV
EEVIDAVWKAARLKPFKVTYTSRQDGDEFVVPCDIVLHGLLAKFTPGMVVNFVWAAEEGK
LPIIGPQGKVIAIENYATSIWRMIQVEWASSSEMNRYVNFWQIREVPGESSSQTSTCILN
TQNYSPAPDRNTVHALQLPEGTRQLQHNKKSVSSSSTEELPTFRLFGQEMTPGVPPRRDG
ASGQASLFSHYLLKDEDELVPTMRKRLEALLPDSTRSPAPTFHTLPSFLVSVAAPAVAKA
SDLYCEEPDRDDDDGLAAILHDAWELPTRPVLRNFNGATFLSKPWLALAVDGHNVVAEPQ
RLMPGLLLPEEMALDPASRAFLSLADGRFP
Download sequence
Identical sequences A0A0E0LHW7
OPUNC07G05200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]