SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC07G09160.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC07G09160.1
Domain Number 1 Region: 653-898
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.45e-36
Family G proteins 0.042
Further Details:      
 
Domain Number 2 Region: 446-638
Classification Level Classification E-value
Superfamily RNI-like 3.45e-31
Family Cyclin A/CDK2-associated p19, Skp2 0.011
Further Details:      
 
Domain Number 3 Region: 961-1184,1224-1366
Classification Level Classification E-value
Superfamily L domain-like 1.28e-30
Family Internalin LRR domain 0.093
Further Details:      
 
Domain Number 4 Region: 145-247
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-28
Family B3 DNA binding domain 0.00004
Further Details:      
 
Weak hits

Sequence:  OPUNC07G09160.1
Domain Number - Region: 1366-1435
Classification Level Classification E-value
Superfamily L domain-like 0.000215
Family Ngr ectodomain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OPUNC07G09160.1
Sequence length 1457
Comment pep:novel chromosome:AVCL00000000:7:11112643:11117260:-1 gene:OPUNC07G09160 transcript:OPUNC07G09160.1 description:""
Sequence
MSGYWRRRRSGKPADVDPAGNPSGGYCREGEKREQAEILSVRPRNTSGGFSDAEYSYGSN
SVGSFAGGLGLDLSLVPTPPASSSLHTSGSRRASGPSDSDQISTRKTSGRWGWGWGRTRR
RPQAPGDADDDVGGGGAAKVIIEKEHMFDKVVTPSDVGKLNRLVIPRKHAECYFPRDVAS
DERGVVLSFEDRAGKPWRFRYSYWNGSRSYVMTKGWSRFVRENRLNAGDTVSFYRGASEV
TRDRLFIHSKRQMQDANLAGGGGTNILPHLGYAGRQGHINLLFQLLVQVRTMVSSFGEAG
SPPPNAPLATVQFFTYKALKDCLQDLHYYSLLSMVGRNHKSQSRSARFVCGVDAKIRDTI
PTLDALIQFRSLSLSDPALQIYGARTVSSHCILLCRGVLGIMGVRCSENMEEEQRMVQVP
AFDDLKYPGHGKITRMEEQTMPLSLANPIYLLPTAITNLLYLDLSNCTDIVQLPPSLGSS
LHKLSALNLSCCYSLHALPDSLVCLYDLQILLLSFCHNLQNLPVPFGDLSNLRLLDLSGC
HSLILLPDSFVNLGSLENLNLSDCISLMGIPQQFGNLRKLEYLNFAGCYIVDLDVYCLSK
LVNLKCLTLSHHTDIKDFPYSFTDLTRHLDLSRWWKNNWVHTQCNLKSYRCHQQSIINKL
LSDGSDEGDITSEQSLTSICIFGESGTGKTELLHEIYNDQMILEGFHLRIWINMCDKKRL
LEKIIEFTTCAYCYDAPSSILEETVREELNGKRFLLVLNDADIEKQCFWTDVWKLANVGA
AGSAFIVTTRSKEVASVFGAMETYDMNILSKEECFMVFQEHAGCGLDINNYHELTKVGWK
IVEKCGSNPLCIKALSGLLCHSETALSEIDSLVGGIVPALRLCYDLLPSCLNQCFKFCSL
FPKDYVFVKHHIIQLWISQGFVYPEEDSHLEDTGLQYFNELFCRSFFQHCPFSNDHEDKF
VMHELFHDLARSVSKDESFSSEEPFFSLHENICHLSLVISDSNTVVLTKEHRHLQSLMVV
RRSASEYSSSFVPLLKILGLNDLLMKCGFLRALNLSCTTIVDLPGSIGMMKHLRFLALNN
TKIKSLPTEIGQLNTLQTLELKDCCCLIELPESTKNLMKLRHLDVQKELGNIHVSMPSGL
GQLTDLQTLTVFNIGDDLSHCSIRDLKNLSGLRGHVHITGLQNITAGDDAKEENLVGKQF
LQALTLEWCCSSEEMEDESDKEIANQVLQNLQPNTSIQELAIQNYPGNLFPNWIKDSCLC
MLVSITIDNSQDCNEIPYLGDLPCLKFLFIQKMYAVENFGQRSNSLTTDGKDAPRFPSLE
ILNLWEMYSLQFWNGTRYGDFPQLHRLSISRCPKLSNLPPLISLVYLSLHCGDQLPALSE
FPSLKSLKIEGFQKLKSVSFCPEMPMLQKLEISDCKELVSIDVPLLSVSNLKVVRCPKLH
FGGSSLEGCLMWEKFKR
Download sequence
Identical sequences A0A0E0LJ93
OPUNC07G09160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]