SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC08G00140.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC08G00140.1
Domain Number 1 Region: 244-300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000188
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OPUNC08G00140.1
Sequence length 402
Comment pep:novel chromosome:AVCL00000000:8:100313:103512:-1 gene:OPUNC08G00140 transcript:OPUNC08G00140.1 description:""
Sequence
MGQMDGGDGGGGGHPYHYQALLAAVHQQTVPFPNPNPFPAPNPSSGDEPPHNHNHNHNHN
THNLNSHNAAPHPCHTPTPRGFADWSASTSAFTSLAAHSSTAPSNAVHYSFSPCYAFWTH
YMLNKNAYPTSFPAPHDEHLRVANNNHPRDAPGPASSYGVESFISPSMAPNICTHMPPLE
GPISAKEDKKPEILPRVVKSSDELETRNSNVELHCETVGTLPESKQGHDSRATKLLNSGE
YQVILRKELTKSDVGNVGRIVLPKKDAEASLPPLLQRDPLILHMDDMVLPVTWKFKYRVN
DAISGTGQITKAECTFWILQMWPLVDSYFVFILADYPRREGHSSADKSLDAFGVNCNSVD
AFEGRTWTYHKLAIQEKLKVSSIFISLVATITWTKLKKRMRL
Download sequence
Identical sequences A0A0E0LQ96
OPUNC08G00140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]