SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC08G09240.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC08G09240.1
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.14e-27
Family N-terminal domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 2 Region: 146-233
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.36e-26
Family Middle domain of MutM-like DNA repair proteins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC08G09240.1
Sequence length 360
Comment pep:novel chromosome:AVCL00000000:8:12075392:12084037:1 gene:OPUNC08G09240 transcript:OPUNC08G09240.1 description:""
Sequence
MPELPEVEVARRALEEHCIGKRIVRCSAADDTKVIDGVAPPRLEAALVGRTISAARRKGK
NLWLALDSPPFPSFQFGMAGAIYVKGVEPSKYKRSALSPTEEWPSKYSKLLVVMDDGLEF
SFTDKRRFAKIRLLGNPEAVPPISELGPDALFEPLHLDDFVESLSRKKAPIKALLLDQSF
ISGIGNWIADEVLYQARIHPMQTASKISKEKCKALHQCIKEVIEKSLEVGCNSSQYPENW
IFHSREKKPGKAFVDGKKIDFITVGGRTSAYVPELQKLDGIDATTSRVKISKDQSKSNKV
AREVDDDEEEAKPAKRGRKQLVKATQEIQEDEEDAKASKRGRKQPAKTSKGSSKKAHHSS
Download sequence
Identical sequences A0A0E0LTK3
OPUNC08G09240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]