SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OPUNC10G15350.1 from Oryza punctata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OPUNC10G15350.1
Domain Number 1 Region: 102-190
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.4e-26
Family B3 DNA binding domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 34-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-16
Family B3 DNA binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OPUNC10G15350.1
Sequence length 358
Comment pep:novel chromosome:AVCL00000000:10:23813805:23814993:-1 gene:OPUNC10G15350 transcript:OPUNC10G15350.1 description:""
Sequence
MEFTPIAPPTRVAGGEEDSERGAAVAAWAVVEKEHMFEKVVTPSDVGKLNRLVIPKQHAE
RYFPLDAAAAGGGGKGLVLSFEDRTGKAWRFRYSYWNSSQSYKVVTPSDVGKLNRLVIPK
QHAERYASAAAAAATGKGLVLSFEDRTGKAWRFRYSYWNSSQSYVMTKGWSRFVKEKRLG
AGDTVSFGRGLGDAARGRLFIDFRRRRQDAGTFMFPPTAAPSHSHHHHHHHQRQLPLPSV
PLCPWRDYTAYGGYGYGGSTPASSRHVLFLRPQVPAAVVLKSVPVHVTASAVQEATTTRP
KRVRLFGVNLDCPAMDDDDIAGAASRTAASSLLQLPSPSSSTSSSTAGKRMCSLDLGL
Download sequence
Identical sequences A0A0E0MA59
OPUNC10G15350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]