SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483346|ref|YP_005392259.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483346|ref|YP_005392259.1|
Domain Number 1 Region: 7-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.5e-37
Family Thioltransferase 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483346|ref|YP_005392259.1|
Sequence length 105
Comment thioredoxin [Rickettsia parkeri str. Portsmouth]
Sequence
MANNVMDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDE
NPNTPSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSLLDWINKSI
Download sequence
Identical sequences A0A0F3QQB8 C3PM30 C4K0B6 H8LN12 Q7PAB0 Q92JR5
gi|238650215|ref|YP_002916065.1| gi|383483346|ref|YP_005392259.1| gi|383750643|ref|YP_005425744.1| 272944.RC0002 347255.RAF_ORF0002 562019.RPR_00010 gi|229586232|ref|YP_002844733.1| WP_004997015.1.22823 WP_004997015.1.23845 WP_004997015.1.24793 WP_004997015.1.29537 WP_004997015.1.29763 WP_004997015.1.33163 WP_004997015.1.3533 WP_004997015.1.41615 WP_004997015.1.42246 WP_004997015.1.47675 WP_004997015.1.49683 WP_004997015.1.54264 WP_004997015.1.55704 WP_004997015.1.93503 WP_004997015.1.95812 gi|15891925|ref|NP_359639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]