SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483392|ref|YP_005392305.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483392|ref|YP_005392305.1|
Domain Number 1 Region: 54-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.76e-28
Family Glutathione peroxidase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383483392|ref|YP_005392305.1|
Sequence length 198
Comment sco2 protein [Rickettsia parkeri str. Portsmouth]
Sequence
MRNNKNQMYIIKIFIALAMITGIIFLCLLYSSLTPSKLKIGAKTSNMDDSPKIKFTLIDQ
EGKKFDSIHLQGHLSLIYFGTTYSLYDNQTLKRVEDIIKILKKENILVQVVFITLDSEHD
TSEVLKKYLEKIDDNFIGLTGRVQDIEQLADQFKVFYTSKIFDVKTNKYELQHSNFVYLI
SSQGKFLKHYYLGLPKNG
Download sequence
Identical sequences A0A0F3QN33
WP_014410287.1.24793 WP_014410287.1.3533 WP_014410287.1.42246 WP_014410287.1.49683 gi|383483392|ref|YP_005392305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]