SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483404|ref|YP_005392317.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483404|ref|YP_005392317.1|
Domain Number 1 Region: 158-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6e-99
Family Extended AAA-ATPase domain 0.00000000163
Further Details:      
 
Domain Number 2 Region: 545-851
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-78
Family Extended AAA-ATPase domain 0.0000000147
Further Details:      
 
Domain Number 3 Region: 4-157
Classification Level Classification E-value
Superfamily Double Clp-N motif 1.47e-32
Family Double Clp-N motif 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383483404|ref|YP_005392317.1|
Sequence length 857
Comment chaperone ClpB [Rickettsia parkeri str. Portsmouth]
Sequence
MNIDKFTAHAKSVIASSQSLAAKNDHQQILPLHLLSSLLSEETGIIQTLINNTGGNITLL
KDQVQLELNKIPKVQVEGGGQVYSSAEALKVLEKASSIAKDSGDSFVTIERIFEALTYDN
TIAGKILTNNGINNKKIATAILQFRKGKKADTESAENSYDALKKYGRDVTELAESGKLDP
IIGRDEEIRRTVQVLSRRMKNNPVLIGEPGVGKTAIIEGLAQRIFSKDVPESLVNCRIIE
LDMGALIAGAKYRGEFEERLKAVLSEIKESSGEIILFIDELHLLVGTGKTDGAMDASNLL
KPMLARGELHCIGATTLDEYRKYIEKDAALARRFQPVYVSEPTVEDTISILRGIKEKYEL
HHAVRISDSAIVAAATLSNRYITDRYLPDKAIDLIDEACSRMKIELSSKPEELDELDRRI
IQIKVELAALKKENDEHSKKKIEHLTTALEKLESQSYDMGAKWQAEKSKLQQTQKLKEEL
DRSRNELERAERDANLAKASELKYGIIPEIMKKIQEAESMDNKGLLKEIVSESDIASIIS
RITGIPIDTMLSSERERLLVMEQKLRESVIGQDKAIKGVSDAVRRSRAGIQDINRPLGSF
LFLGPTGVGKTELTKALAGFLFDDRNAILRIDMSEYMEKHAISRLIGAPPGYIGYDQGGV
LTEAVRRRPYQVILFDEVEKAHPDIFNIMLQILDEGRLTDSQGITVDFKNTIIVLTSNLG
AEVLVNQKEDEDTYKVKDEVMEYVKAVFKPEFLNRLDEIILFHRLNRNNIHDIVKIQLES
LKKILLAQNIILEFDESALNYLAEKGYDPSFGARPLKRLIQREIQNNLAKMILAGEISSG
KTVKINSKDKELKVTMS
Download sequence
Identical sequences A0A0F3QND7
WP_014410296.1.24793 WP_014410296.1.3533 WP_014410296.1.42246 WP_014410296.1.49683 gi|383483404|ref|YP_005392317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]