SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483445|ref|YP_005392358.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483445|ref|YP_005392358.1|
Domain Number 1 Region: 29-476
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.57e-163
Family Type II DNA topoisomerase 0.00000000258
Further Details:      
 
Domain Number 2 Region: 507-735
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 4.05e-43
Family GyrA/ParC C-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483445|ref|YP_005392358.1|
Sequence length 738
Comment DNA topoisomerase IV subunit A [Rickettsia parkeri str. Portsmouth]
Sequence
MKEAKVENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRRLLYAMLQLRLEPNSG
YKKCARVVGDVIGKYHPHGDVAVYDTLVRLAQHFSLRYPLIDGQGNFGSIDGDNAAAMRY
TESRMTDICTLLMEDIDKDTVDFRPTYDGSDLEPVIMPASFPNLLANGSEGIAVGMATNI
PPHNLHELCDALIHLINHPKAEINDIINFVKGPDFPTGGIIIDKAEVINAAYTTGRGSLR
VRSRWEKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKDKKIPLVSNIRDESTDIIRL
VIEPRDRGCDPQIVMESLFKLTNLESRIQLNMNVIGSNNVPRVMNILEILQEFLYHRQNI
VTRRSTYLLNKIKHRLEILKGLRIAYLNLDEIIKIIREEDEPKAIMMERFKLTEIQVEAI
LNTRLRSLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKTVQTKFGLNTV
IGARRTSFEEVTLTNQVVDITAFITKEPITIICSKMGWVRSLKGHNTDLSTIKYKEGDAE
KFILEAYTTDKILIVSSEGRFFTLLADNISKGKGTGESIKLLVDIGNNDITNILVYKPDQ
LLLLASSVGKGFLVNSNEVMAQTKTGKQIMNVPDGHVCIACLPVNGDSIACIGESRKLLV
FNIDEIPEMKKGQGVTLQKFKNAKLLDIKIFNKEDGLGWNNNGKVKLEKNIVAFLGKRGS
TGKLPPMGFPKNNRFSSY
Download sequence
Identical sequences A0A0F3QLG8
WP_014410327.1.24793 WP_014410327.1.3533 WP_014410327.1.42246 WP_014410327.1.49683 gi|383483445|ref|YP_005392358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]