SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483453|ref|YP_005392366.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483453|ref|YP_005392366.1|
Domain Number 1 Region: 295-464
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.85e-71
Family Transhydrogenase domain III (dIII) 0.000000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483453|ref|YP_005392366.1|
Sequence length 465
Comment NAD(p) transhydrogenase subunit beta [Rickettsia parkeri str. Portsmouth]
Sequence
MSLQIIQLLYLVAAVCFILSLKFLSSQKQAHLGSTIGILGMAIAVIVTFFLPGFTHKLPI
IATILLGAVIGGIIALKISMTAMPQLVAGFHSFVGLAAVFVAYATVLAPENFSIGIAGSL
PINALIEISVGVSIGALTFSGSIIAFLKLQGLMKSSPLKFYGQQYICLLTAIILVILVIS
FIRSENIFLFNLIVFLSLLIGVLLIIPVGSADMPVIVSMLNSYSGFAAAGIGFTLSNSLL
IITGALVGSSGAILSYIMCKAMNRSLIKVIFGAFLPAPTGINKDIDDDKIAKTSCPEDAA
YLLLNTSSVIIVPGYGMAVAQSQHIIKEMVDILERSDINVRFAVHPVAGRMPGHMNVLLA
EANIDYEKVLELEEINRDFATTDVVLVIGANDVTNPAAKNDPNSPIYGMPILDVEKARTI
LFIKRSMASGYAGIKNALFYHDNTFMLFGDAKKVVEEIVKFLNED
Download sequence
Identical sequences A0A0F3QNT5
gi|383483453|ref|YP_005392366.1| WP_014410330.1.24793 WP_014410330.1.3533 WP_014410330.1.42246 WP_014410330.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]