SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483460|ref|YP_005392373.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483460|ref|YP_005392373.1|
Domain Number 1 Region: 1523-1800
Classification Level Classification E-value
Superfamily Autotransporter 1.01e-30
Family Autotransporter 0.016
Further Details:      
 
Weak hits

Sequence:  gi|383483460|ref|YP_005392373.1|
Domain Number - Region: 1056-1065
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483460|ref|YP_005392373.1|
Sequence length 1802
Comment hypothetical protein MC1_00650 [Rickettsia parkeri str. Portsmouth]
Sequence
MTSSFLSTSARAASFKDLVSKTPAWEKHNSTQQQNIWKDLTPNEKIKKWQEAALVPSFTQ
AQNDLGIKYKETDLSSFLDNTRHKARQARAEILLYIERVKQQDFDTKKQEYINQGVVPTD
IEAATNLGISYDPSKIDNKVEHDQKVRRAEKDKKAVIELYISSINRGIKYKHYVDNDIIP
EMQEVRTALNMNKDDAQSFVASIRTEIMENAKGQYIADSHIPTEKELKKKFGISRDDNRD
GYIKSIRLKVMDKEKPQYIADSHIPTEKELEQKFGVDKGEATNYIASIATQMMLGKKSYY
IDNNIIPNADELMNEFKIGPVKATSYINQIKAGIEANQFLNNNDTTKPSTGRSQQKSGSK
NNPWYMSNQSIHNTETSSQISTGRDKKQRYFFDSISTFKTQFNAKANKGNLTLSQQNINK
LIEQEENIEQFKDLIKTNPIAALLLQVDSSYKNQAVKIILKDRNDNTIQRLLFTNDTGQL
DFNTNIKVKNRPILQTFLNNSTSKDKTKFAEIIQDYATRNISNSQFEEKARLDLIKIAAS
KDKSSVENFLTLQLELKNRMQPYIVNSVYILTPEIVKEINIELKNKGLIRDSLTKDYMIK
LAKEVNNHTLNSVIKVILSDSNILSNEANKILGLAVGNNANNLEQTQSDIPNPPPLPLNG
GIPNPPPLPLNGSIPPPPLHSQGFISNSQHFDLNQLQTEYPHIHSLYIQFTHNTTVQSKA
PLQPTASSTTSTVRSTPETAYAKLYAEYRTETGGTKANDLQDQLIKRQADLTNVIRQILT
ESYANQGADEKTLLNLFSISTPEIAEKAKEAFNTLAQDQYIKDITVNGKKTITSEEIIKN
LFNEDTDDAVKRILLSSCKISEELKRPIKLKFNQSELIRKLQGKQNPFEQLEFAYINAKN
FDQDIFGNRVDELINNPNILTIVQQATFLITEDTNLRKTINSDQAQAKLDDLRTAILSTI
KFEELITANLPQHDFIAIVKEKDPELLKEFLKATTLKVTGNNNLDQLRLALPSFTGMSNE
QIRILSNKLNLSIILQALQECSQEKATKYIHTGNMPPPPPPPPLPNSQDLESAYLASLGI
TKSTSTFKTKTTPKTYHFRSDIALKYKEFTLSGQKSAGYKAAYSDADLLKKAIVESVAFE
HSKNLSEAHQNTDYFEQVEEAVNTMHSSFTGPRTEMGQIIHNIYISKLLELTKDKEFIKY
VEDNIILNKKLTKAFTSAGSGFIDSRTRLEQKIHDIYIQQLTKYPEEEAVKEAFNTANPD
FIGPRTEIGQEVHNIYKSQLLELTKDQELFLFTQQILAESTELEQKYGSDIQSENSDNEK
TVGRLDNEKTVGRLDNEKTVGRLDNEKTVGRLDQEKLQSFKQENEATNDESSTKDDTQPE
DSNKKSEQSDSKTALSPRLLSSNDSKNDKSSDDKKSLLALRSSDEDDTGYATDEEELEES
NSTTDEELKKDVVLESEDEAIDVSFKTEAITEQDEVTQRQQVSDYTSGKVAILVQATSTL
HKPVHYNINDRLTIAAIGAGDEETSINRGVWISGLYGINKQRIWKNIPKYQNRTTGITIG
TDAEFINSHDVIGIAYSRLESQIKYNKKLGKTTVNGHLLSIYSLKELINGFSLQTITSYG
HNYIKNRSKNINNIIGKYQNNNLSFQTLLNYKYRTKYDLHFIPNIGFQYDYSRASNYKEY
NVDIENLMIQKKSNQLFESSLGGKIVFKPIVTTNNIVLTPSLYGNIEHHFNNKNTKVNAK
ATFKGQTLQETIITLKQPKLGYNIGSNILMSRKNINVLLEYNYYTHRKYQSHQGLIKLKV
NL
Download sequence
Identical sequences gi|383483460|ref|YP_005392373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]