SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483506|ref|YP_005392419.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483506|ref|YP_005392419.1|
Domain Number 1 Region: 53-190
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 1.7e-26
Family Band 7/SPFH domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383483506|ref|YP_005392419.1|
Sequence length 286
Comment Membrane protease subunit, stomatin/prohibitin-like protein [Rickettsia parkeri str. Portsmouth]
Sequence
MQQKIYYIIFTIVFGLILISSSLFSVDQRQSAVVFQFGEAVRTIENPGLNIKIPFIQNVE
FFDKRLLDVEVEAKELTAADGKRVIVDAYAKFQINNPVMFYKTVHDYQGVKIRLTRNLES
SMRKVIGKISLSSLLSQERSNVMLNILNQVDGEAKSFGIDVVDVRILRADLPKENSAAIY
RRMQTAREKEATQIRAEGQEESVRIRSKADKESKIILAKAYRDAQIIKGDGDEKAAKIYN
SAYSVDPEFYKFYRSLLVYKNSLKKENTNFVISPDAEVLKYLNLTK
Download sequence
Identical sequences A0A0F3QN55 A0A0H3AVV8 B0BW93 C4K1Q5 H6PW84 H8LLN6 Q7PAR5
gi|379017338|ref|YP_005293572.1| gi|379018668|ref|YP_005294902.1| gi|383750801|ref|YP_005425902.1| gi|378720838|ref|YP_005285725.1| gi|165932736|ref|YP_001649525.1| gi|238650701|ref|YP_002916554.1| gi|157828038|ref|YP_001494280.1| WP_004996654.1.16657 WP_004996654.1.17801 WP_004996654.1.22172 WP_004996654.1.22823 WP_004996654.1.24793 WP_004996654.1.31136 WP_004996654.1.3339 WP_004996654.1.3533 WP_004996654.1.38731 WP_004996654.1.41615 WP_004996654.1.42246 WP_004996654.1.4490 WP_004996654.1.47675 WP_004996654.1.49683 WP_004996654.1.54264 WP_004996654.1.55704 WP_004996654.1.74071 WP_004996654.1.76853 WP_004996654.1.77680 WP_004996654.1.78650 WP_004996654.1.81845 WP_004996654.1.83836 WP_004996654.1.89241 WP_004996654.1.93503 WP_004996654.1.95812 gi|374318904|ref|YP_005065402.1| gi|379711905|ref|YP_005300244.1| 392021.A1G_00950 452659.RrIowa_0206 562019.RPR_04040 gi|379016900|ref|YP_005293135.1| gi|378722191|ref|YP_005287077.1| gi|378723550|ref|YP_005288434.1| gi|383483506|ref|YP_005392419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]