SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483509|ref|YP_005392422.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483509|ref|YP_005392422.1|
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 5.45e-32
Family Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383483509|ref|YP_005392422.1|
Sequence length 124
Comment succinate dehydrogenase cytochrome b-556 subunit [Rickettsia parkeri str. Portsmouth]
Sequence
MTKTKQEIYNKRPTSPHLTIYKPQISSTLSILYRMTGVALFFAVSILVWWLILSKYDNNY
LQLAECCIIKICLVAVSYAWFYHLCNGIRHLFWDIGYGFSIKLVNITGWCVVVGSVLLTV
LLWV
Download sequence
Identical sequences A0A0F3QQS9 C3PMG4 Q92J99
gi|229586366|ref|YP_002844867.1| WP_010976843.1.22172 WP_010976843.1.23845 WP_010976843.1.24793 WP_010976843.1.29537 WP_010976843.1.33163 WP_010976843.1.3533 WP_010976843.1.42246 WP_010976843.1.49683 272944.RC0168 347255.RAF_ORF0157 gi|15892091|ref|NP_359805.1| gi|383483509|ref|YP_005392422.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]