SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483516|ref|YP_005392429.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483516|ref|YP_005392429.1|
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.37e-111
Family G proteins 0.0000000168
Further Details:      
 
Domain Number 2 Region: 481-607
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-38
Family Translational machinery components 0.0000522
Further Details:      
 
Domain Number 3 Region: 249-274,304-401
Classification Level Classification E-value
Superfamily Translation proteins 7.57e-35
Family Elongation factors 0.0001
Further Details:      
 
Domain Number 4 Region: 611-695
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.87e-30
Family EF-G/eEF-2 domains III and V 0.0000584
Further Details:      
 
Domain Number 5 Region: 403-480
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-24
Family EF-G/eEF-2 domains III and V 0.000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483516|ref|YP_005392429.1|
Sequence length 699
Comment elongation factor G [Rickettsia parkeri str. Portsmouth]
Sequence
MSKINKLEHIRNIGICAHIDAGKTTTTERILYYTGKSHKIGEVHEGGATMDWMEQEQERG
ITITSAATTCRWQDKIINIIDTPGHVDFTIEVERSLRVLDGAVAVFDGVAGVEPQSETVW
RQADKYNVPRMCFVNKMDRMGADFYRCVEMLKDRLGAKPLVIQLPVGIEENFKGIIDLIK
MKAVIWKDEALGAEYFEEDIPADMKDKAEEYRAKLLDMVVELDDHVMEKYLSGEEVTAEE
IKRLIRKGTISAVFYPVLCGSAFKNKGVQPLLDAVVDFLPSPIDIGIVKGMEVSTGEEKD
FPISVTEPFAALAFKIMNDPFVGSLTFIRIYSGKITSGTTVINTVKNKREKIGRMLLMHA
NNREDVKEASAGDIVALAGLKDTTTGDTLSDIDQQVILERMEFPEPVIELAVEPKSTADQ
EKMGLALSRLAAEDPSFRVSTDYETGQTVIKGMGELHLEIIIDRMRREFKVEANIGAPQV
AYRETITKVCEIDYTHKKQSGGAGQFARVKIIFEPLKEVKDLKDEDKNKIFVFESKIIGG
AVPKEYIPGVEKGLNNIRETGVIAGYPMIDFKATLVDGAFHDVDSSVLAFEIAAKAAFRE
GMPKGNPKLLEPIMQVEVITPDEYMGDIIGDLNSRRGQIQSMDPRGNAQVVTANVPLAEM
FGYVNTLRSLSQGRAQFSMIFSHYDQVPSQVADIIKAKK
Download sequence
Identical sequences A0A0F3QQ20
WP_014410374.1.24793 WP_014410374.1.3533 WP_014410374.1.42246 WP_014410374.1.49683 gi|383483516|ref|YP_005392429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]