SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483530|ref|YP_005392443.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|383483530|ref|YP_005392443.1|
Domain Number - Region: 537-580
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.0484
Family Anticodon-binding domain of PheRS 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483530|ref|YP_005392443.1|
Sequence length 704
Comment hypothetical protein MC1_01050 [Rickettsia parkeri str. Portsmouth]
Sequence
MSKEKTQQGLLLQEQLFKALKTNDTELNAKISRTCKGIAESVIDLSNDQSPTAESLYISY
MALADLNTKDLAKVTTIIKNSFPGDKNKKLREIIDAPLLEHLVMIEAIERQVGLDDSRYN
ADYRKREEIRNPNDPKKVIDAMLRDKRVAQQAEFEEKGKKAAGVSAGYVAKDNAGNTFIL
KHFYKTHAACQKIQGNHAQRQAMADRRDGVQELIGSTMYQFLLHDRAPKEGLVTADEQHP
DSLYVRSKFFDNAVTLTEFSGLSGETRVRDNDQNLKKLEGFEKAIAACHMLGEVDYHAGN
LMVQDGKTITKIDHGRSFLAFHKNFSSMIQSTAKMFTHPGVGYSAAIKAGNFSFSIDKYS
ESLNQMISQFDEKQMEAIVDQKIDELNKAGFDPKNIMLSTNIQNFDDLRKHYKSSIKENL
VNMQEVAKGAEIVTKFSNVSPEFKNGGWLEAFANSPVKDPVLYAIDNNITIEGKDAKEWA
YENNYQIKISIGLKKETIKEQQWSKDLDGKWKEKEVEVKTDKVEVQISDPAKSMRIQDKS
TGEKLASLIVDFTKQATTKNVTDKAVAKFYDNIMKVLKKENYLTEQDIKGIKKNLKYQDN
IENTTNLLNAKSFKLNSKDTIYYKVGIFCEKRGLPSISNYFMKQISPENLNKIHNTEKLI
AESIKIGNILQQKKQERLQTKRVETVKEIAFSQLQARKEKHQQR
Download sequence
Identical sequences A0A0F3QQF0
gi|383483530|ref|YP_005392443.1| WP_014410383.1.24793 WP_014410383.1.3533 WP_014410383.1.42246 WP_014410383.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]