SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483537|ref|YP_005392450.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483537|ref|YP_005392450.1|
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Glu-tRNAGln amidotransferase C subunit 8.76e-22
Family Glu-tRNAGln amidotransferase C subunit 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383483537|ref|YP_005392450.1|
Sequence length 100
Comment aspartyl/glutamyl-tRNA amidotransferase subunit C [Rickettsia parkeri str. Portsmouth]
Sequence
MITKEEAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNAR
MREDAVTSSDLSSELFDNVSGNSAQLAKEVKYFITPKVVE
Download sequence
Identical sequences A0A0F3QR21 H8LM24
gi|383483537|ref|YP_005392450.1| gi|383750832|ref|YP_005425933.1| WP_014410388.1.22823 WP_014410388.1.24793 WP_014410388.1.3533 WP_014410388.1.42246 WP_014410388.1.47675 WP_014410388.1.49683 WP_014410388.1.54264 WP_014410388.1.55704 WP_014410388.1.95812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]