SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383483552|ref|YP_005392465.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483552|ref|YP_005392465.1|
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Bet v1-like 4.84e-28
Family oligoketide cyclase/dehydrase-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383483552|ref|YP_005392465.1|
Sequence length 146
Comment oligoketide cyclase/lipid transport protein [Rickettsia parkeri str. Portsmouth]
Sequence
MPCLQHTKILPYKPQELFDLVWDVKSYPKFLPWCSASRIISENNQEVIAELVIQLKGFSE
KYNSRVTSEITDDGIYLINTVAISGPFEYLKSTWQFVPCTAGTALKFFIDFKMKSVILDK
LIGTYFTKATEKMIIAFERRAKEVIK
Download sequence
Identical sequences A0A0F3QM70 C4K2M8 Q7PAV7
562019.RPR_06690 gi|383483552|ref|YP_005392465.1| gi|238651021|ref|YP_002916877.1| WP_004996594.1.22823 WP_004996594.1.24793 WP_004996594.1.3533 WP_004996594.1.42246 WP_004996594.1.47675 WP_004996594.1.49683 WP_004996594.1.93503 WP_004996594.1.95812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]