SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483580|ref|YP_005392493.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483580|ref|YP_005392493.1|
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-31
Family Chaperone J-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 261-347
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.57e-22
Family HSP40/DnaJ peptide-binding domain 0.0036
Further Details:      
 
Domain Number 3 Region: 136-213
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 2.22e-20
Family DnaJ/Hsp40 cysteine-rich domain 0.00011
Further Details:      
 
Domain Number 4 Region: 120-154,215-259
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 7.72e-20
Family HSP40/DnaJ peptide-binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383483580|ref|YP_005392493.1|
Sequence length 373
Comment chaperone protein DnaJ [Rickettsia parkeri str. Portsmouth]
Sequence
MSQNYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKDAEKKFKEINAAYDVLKDEQK
RAAYDRLGHDAFQNQQSRGGGGNHGGFHPDINDIFGDFFSDFMGDSRRSSRPTSAKVRGS
DLKYNLTINLEEAFHGIEKNISFSSAVKCDTCHGSGSEKGETVTTCDACSGVGATRMQQG
FFTIEQACHKCQGNGHIIKNPCKKCHGMGRYHKQRNLSVNIPAGVENGTRIRHTGEGEAG
IRGGNSGDLYVDITIKPHDIYKVDGANLHCKLPISFVNAALGGEIEVPVIEGGKVNLTIP
AGTQNGDQLRLRSKGMSKMRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESINEKEN
DGSFFNKMKSLWS
Download sequence
Identical sequences A0A0F3QMA0
WP_014410416.1.24793 WP_014410416.1.3533 WP_014410416.1.42246 WP_014410416.1.49683 gi|383483580|ref|YP_005392493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]