SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483613|ref|YP_005392526.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483613|ref|YP_005392526.1|
Domain Number 1 Region: 7-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.39e-25
Family Thioltransferase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383483613|ref|YP_005392526.1|
Sequence length 102
Comment glutaredoxin 3 [Rickettsia parkeri str. Portsmouth]
Sequence
MNKAILHTIIVYTLASCPYCIKAKALLDEKNVAYEEIEVSNFTQEEKEKFIKKSGGKKTV
PQIFIDNMHVGGCDALFDLEKEGRLDKLLENQPKTTSPAAGA
Download sequence
Identical sequences A0A0F3QQ23 A0A161QNF3 A0A1Q2ST20 G4KMC4 H8LMA1 Q92J02
gi|350273258|ref|YP_004884571.1| 272944.RC0267 gi|383483613|ref|YP_005392526.1| gi|15892190|ref|NP_359904.1| WP_010976927.1.1442 WP_010976927.1.23845 WP_010976927.1.24793 WP_010976927.1.33163 WP_010976927.1.3533 WP_010976927.1.42246 WP_010976927.1.46231 WP_010976927.1.49683 WP_010976927.1.54113 WP_010976927.1.54264 WP_010976927.1.55704 gi|374318990|ref|YP_005065488.1| gi|383750909|ref|YP_005426010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]