SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483650|ref|YP_005392563.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483650|ref|YP_005392563.1|
Domain Number 1 Region: 415-647
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.8e-73
Family Type II DNA topoisomerase 0.0007
Further Details:      
 
Domain Number 2 Region: 20-222
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.26e-54
Family DNA gyrase/MutL, N-terminal domain 0.00000541
Further Details:      
 
Domain Number 3 Region: 242-412
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.54e-38
Family DNA gyrase/MutL, second domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383483650|ref|YP_005392563.1|
Sequence length 662
Comment DNA topoisomerase IV subunit B [Rickettsia parkeri str. Portsmouth]
Sequence
MSDLFSFNKEKKNKLVDNNYSAKDIEVLEGLEPVRKRPGMYIGGTDSNAMHHLVSEVLDN
AMDEAVAGFASIITITMHHDHSITIFDNGRGIPIDNHPKFPDKSALEVILTTLHSGGKFS
NNVYHTAGGLHGVGISVVNALSKHLEIKVYKQGKLYSQSYSKGEKLTDLICEEASKRLRG
TSINFTPDPEIFSEKLHFNPKKIYELARSKAYLYRGVTIEWACEVEVQSDIPKKALISFP
NGLKDYLSSKITLDNLVIPGIFAGNIESTSDRIKLEWAICWQNNDSSAFVQSYCNTVPTP
QGGTHEQGLKSAILRGLKAYGEMIGNKKAANLTIEDILETASVVLSIFIAEPSFQGQTKE
KLVSNGVSKPVENIIKDHFDHFLSSDKALATNLLEHVISIAEFRISKKNEKNISRKNATQ
KLRLPGKLADCTRTSPEGTELFIVEGDSAGGSAKQARNRETQAVLPLWGKVLNVASSTLE
KIVNNQAIQDLEIALACGSLKNYKKENLRYEKIIIMTDADVDGAHIASLLMTFFFLRMPK
LVEEGHLYLAKPPLYRLTQSNKTYYAGDEEEKAKLTDKLLKASKAKIEVGRFKGLGEMMP
AQLKETTMHPEKRSLLKVTLADFQNVDKIVDDLMGKKPEKRFQFIYEQALVKMDKIISEL
DI
Download sequence
Identical sequences A0A0F3QLM0 Q7PB47
WP_004996386.1.24793 WP_004996386.1.3533 WP_004996386.1.42246 WP_004996386.1.47675 WP_004996386.1.49683 WP_004996386.1.95812 gi|383483650|ref|YP_005392563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]