SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483657|ref|YP_005392570.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483657|ref|YP_005392570.1|
Domain Number 1 Region: 35-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.1e-46
Family Translational machinery components 0.0000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383483657|ref|YP_005392570.1|
Sequence length 159
Comment 30S ribosomal protein S9 [Rickettsia parkeri str. Portsmouth]
Sequence
MPELKIKTEKVEKQLTKEPLVLKTPKEKIDNLGKFYATGKRKNAIARVWLKVGKGKIVVN
KKTIAQYFPSETYVKTILKPFVLTKTIDQYDIICTVRGGGISGQKGAILHGISKALDKAA
PDFHAILRKGGLLTRDSRVVERKKYGQRKARKKTQFSKR
Download sequence
Identical sequences A0A0F3QMY3
WP_014410469.1.24793 WP_014410469.1.3533 WP_014410469.1.42246 WP_014410469.1.49683 gi|383483657|ref|YP_005392570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]