SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483702|ref|YP_005392615.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483702|ref|YP_005392615.1|
Domain Number 1 Region: 23-215
Classification Level Classification E-value
Superfamily Cytochrome c 9.05e-73
Family Cytochrome bc1 domain 0.00000263
Further Details:      
 
Domain Number 2 Region: 216-251
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0000183
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483702|ref|YP_005392615.1|
Sequence length 251
Comment cytochrome c1, heme protein [Rickettsia parkeri str. Portsmouth]
Sequence
MKTKLLISIIILLTSCLSLANEEVLHPKKMKWSFDGVFGTVNREAAQRGFQVYKEVCSVC
HGLNNLYYRNLKDIGFSDDEIKEIAKGYTIQDGPNDDGEMFDRPALPSDRFVPPYPNEQA
ARAANNGAHPPDLSLIIKARHDGANYIYSLLTGYTEPPADFKLMQGTHYNPYFPGEQIAM
PPPLTDGQVTYMDGTNASVEQMSQDIVVFLQWAAEPEMEHRKSMGLKVMMFLAVFTIFFY
IAKNRIWSNLK
Download sequence
Identical sequences A0A0F3QQ43 C3PMX0
WP_012719530.1.22172 WP_012719530.1.24793 WP_012719530.1.29537 WP_012719530.1.3533 WP_012719530.1.42246 WP_012719530.1.49683 gi|229586522|ref|YP_002845023.1| 347255.RAF_ORF0334 gi|383483702|ref|YP_005392615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]