SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483711|ref|YP_005392624.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483711|ref|YP_005392624.1|
Domain Number 1 Region: 3-45
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000052
Family SinR domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383483711|ref|YP_005392624.1|
Sequence length 46
Comment Plasmid maintenance system antidote protein [Rickettsia parkeri str. Portsmouth]
Sequence
MISYLALLVHGKRTLTTDMALRLGKYFHTSAQLWINLQARYDLKLA
Download sequence
Identical sequences WP_014410510.1.22823 WP_014410510.1.24793 WP_014410510.1.3533 WP_014410510.1.42246 WP_014410510.1.49683 gi|383483711|ref|YP_005392624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]