SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483773|ref|YP_005392686.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483773|ref|YP_005392686.1|
Domain Number 1 Region: 7-180
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.42e-56
Family Proteasome subunits 0.00000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483773|ref|YP_005392686.1|
Sequence length 182
Comment ATP-dependent protease subunit HslV [Rickettsia parkeri str. Portsmouth]
Sequence
MSDNLSLHGTTILCLKKNEEIIIAADGQVSHGNTVLKSTARKLRTIANNKIIAGFAGSTA
DGLALFEKLAVKIEQHKHNLLRSAVELAKDWRSDKYLRRLEAMMIVADRSHILILTGNGD
VVEPENNVAAIGSGGLFALSAARALMSYENNLTAEEIALKSMNIAADLCVFSNHNIIMEK
VV
Download sequence
Identical sequences A0A0F3QRL8 A8GRL7 B0BX21 C3PN29 H6PT68 H8LLR5 Q7PBF5 Q92II7
gi|383483773|ref|YP_005392686.1| gi|379017613|ref|YP_005293848.1| gi|379016623|ref|YP_005292858.1| gi|229586581|ref|YP_002845082.1| gi|378722468|ref|YP_005287354.1| gi|157828308|ref|YP_001494550.1| 272944.RC0433 347255.RAF_ORF0402 392021.A1G_02455 452659.RrIowa_0517 WP_004996101.1.16657 WP_004996101.1.17801 WP_004996101.1.22172 WP_004996101.1.22823 WP_004996101.1.23845 WP_004996101.1.24793 WP_004996101.1.29537 WP_004996101.1.29763 WP_004996101.1.31136 WP_004996101.1.3339 WP_004996101.1.3533 WP_004996101.1.38731 WP_004996101.1.41615 WP_004996101.1.42246 WP_004996101.1.4490 WP_004996101.1.47675 WP_004996101.1.49683 WP_004996101.1.54264 WP_004996101.1.55704 WP_004996101.1.74071 WP_004996101.1.76853 WP_004996101.1.77680 WP_004996101.1.78650 WP_004996101.1.81845 WP_004996101.1.83836 WP_004996101.1.89241 WP_004996101.1.95812 gi|379712183|ref|YP_005300522.1| gi|374319141|ref|YP_005065640.1| gi|378721114|ref|YP_005286001.1| gi|165933014|ref|YP_001649803.1| gi|378723824|ref|YP_005288708.1| gi|15892356|ref|NP_360070.1| gi|383751083|ref|YP_005426184.1| gi|379019220|ref|YP_005295454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]