SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483792|ref|YP_005392705.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483792|ref|YP_005392705.1|
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.95e-61
Family Glutathione peroxidase-like 0.00000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383483792|ref|YP_005392705.1|
Sequence length 200
Comment thioredoxin peroxidase 1 [Rickettsia parkeri str. Portsmouth]
Sequence
MSVFVGKTAPDFTAKAIMPNNNIDDKFKLSHYAAGDNIVLFFYPLDFTFVCPSEIIAFHN
KLGEFTERRTKVVAVSVDSHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNE
DGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVIDALTHHQKHGEVCPAGWHKGEE
AITPSHEGIAHYLSSHAEKL
Download sequence
Identical sequences A0A0F3QRL0
gi|383483792|ref|YP_005392705.1| WP_014410575.1.24793 WP_014410575.1.3533 WP_014410575.1.42246 WP_014410575.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]