SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483793|ref|YP_005392706.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483793|ref|YP_005392706.1|
Domain Number 1 Region: 49-183
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 1.44e-37
Family Band 7/SPFH domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383483793|ref|YP_005392706.1|
Sequence length 312
Comment Membrane protease subunit, stomatin/prohibitin-like protein [Rickettsia parkeri str. Portsmouth]
Sequence
MEYALLIFSIIAILVIIQMVKVVPQQQAWVVEKLGKFDKVLQPGLNLLIPVIQRVAYKHT
LKEEAIDVTAQTAISNDNVTLSIDGVLYVKIIDPMAASYGVNNPYYAITQLAQTTMRSEI
GKLPLDRTFEERETLNVAIVAAINQAAINWGIQCMRYEIKDIQPPQTILKAMELQVAAER
QKRAQILESEGNRQAKINHAEGEKAQIVLNSEASYTDQVNRAKGEAEAIGLVATATANSI
EIVATAVQKTGGSDAVALKIAEQYISAFGNLAKDTNTVILPANLSEPSSFITEALTIFNQ
LKASSSGTKIDK
Download sequence
Identical sequences A0A0F3QPQ1 C3PN43 C4K2S1 H8LLT3 Q7PBH3 Q92IG8
gi|229586595|ref|YP_002845096.1| gi|238651063|ref|YP_002916920.1| gi|15892375|ref|NP_360089.1| gi|383751101|ref|YP_005426202.1| 272944.RC0452 347255.RAF_ORF0421 562019.RPR_07055 gi|383483793|ref|YP_005392706.1| gi|374319154|ref|YP_005065653.1| WP_004996064.1.22172 WP_004996064.1.22823 WP_004996064.1.23845 WP_004996064.1.24793 WP_004996064.1.29537 WP_004996064.1.29763 WP_004996064.1.33163 WP_004996064.1.3533 WP_004996064.1.42246 WP_004996064.1.47675 WP_004996064.1.49683 WP_004996064.1.54264 WP_004996064.1.55704 WP_004996064.1.93503 WP_004996064.1.95812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]