SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483838|ref|YP_005392751.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483838|ref|YP_005392751.1|
Domain Number 1 Region: 28-126
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000058
Family L-arabinose binding protein-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383483838|ref|YP_005392751.1|
Sequence length 305
Comment ABC transporter periplasmic protein [Rickettsia parkeri str. Portsmouth]
Sequence
MFISNIFQKFFSFLFVLFITAAVYADQKKVAVIVPLEHAAMTEIISGIKESLKDIDAEII
VKNAHADSNILLAIIKQIIDQDIDVIIPIGTTASQTVISHITNKPIVCAAAMINSKNLPL
VTGVNDEIKITDTISKLPFLQNITLIYSSSEKVIPEVEMLKLYAGKNNISLHTVIIQNFN
DMPVAVKNAPENTQSFIILKDHLIVSGINILKQEAFKRRIPIIASDEGSVISGATIAVGV
QEKQIGVEAGLMAKKILQGIEPKDIPFGDMKDLTLFINLKSFVKQDILTKENLSVLPFAR
KELEE
Download sequence
Identical sequences A0A0F3QLJ2
WP_014410605.1.24793 WP_014410605.1.3533 WP_014410605.1.42246 WP_014410605.1.49683 gi|383483838|ref|YP_005392751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]