SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483863|ref|YP_005392776.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|383483863|ref|YP_005392776.1|
Domain Number - Region: 15-47
Classification Level Classification E-value
Superfamily Prokaryotic ribosomal protein L17 0.0445
Family Prokaryotic ribosomal protein L17 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483863|ref|YP_005392776.1|
Sequence length 60
Comment ankyrin repeat-containing protein [Rickettsia parkeri str. Portsmouth]
Sequence
MTYKQMTEVLHYCGRNLVENKIILSLLMHNNANTNFTKANLVRQCKEPYEEAERLIKLKK
Download sequence
Identical sequences A0A0F3QPW2
WP_014410623.1.22823 WP_014410623.1.24793 WP_014410623.1.3533 WP_014410623.1.42246 WP_014410623.1.47675 WP_014410623.1.49683 WP_014410623.1.95812 gi|383483863|ref|YP_005392776.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]