SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483873|ref|YP_005392786.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483873|ref|YP_005392786.1|
Domain Number 1 Region: 79-255
Classification Level Classification E-value
Superfamily Fic-like 2.88e-38
Family Fic-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383483873|ref|YP_005392786.1|
Sequence length 322
Comment Cell filamentation protein Fic [Rickettsia parkeri str. Portsmouth]
Sequence
MNSKPSFQITNKILELSQDISYELGILAGSKLYSQPIKLRKNNQIKTIHSSLAIEGNSLS
VEQITDIINDKRVLAPEKDIVEVKNAIKLYNNLTIFNPFKIESLLKAHEILMQGLVEDNG
KWRKGNAAIFKGTEIIYFAPTARRVSLLMQDLFEFIAQDKQISGIVKACIFHYEFEFIHP
FSDGNGRIGRLWQQLLLMQANKIFEYISVESLIRNNQSEYYSVLSKCDKLGESTLFIEFM
LDKIVAALRLYSNNITYEANTPLSRMEFAKVNLIDQWFSRKDYITVHKNISTATASRDLL
YGLERKLLISKGYKNQTYYKFV
Download sequence
Identical sequences A0A0F3QR60
WP_014410631.1.24793 WP_014410631.1.3533 WP_014410631.1.42246 WP_014410631.1.49683 gi|383483873|ref|YP_005392786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]