SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483922|ref|YP_005392835.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483922|ref|YP_005392835.1|
Domain Number 1 Region: 201-420
Classification Level Classification E-value
Superfamily PheT/TilS domain 9.15e-58
Family B3/B4 domain of PheRS, PheT 0.0000679
Further Details:      
 
Domain Number 2 Region: 489-708
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.14e-40
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0006
Further Details:      
 
Domain Number 3 Region: 40-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.92e-36
Family Myf domain 0.0027
Further Details:      
 
Domain Number 4 Region: 722-817
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.57e-24
Family Anticodon-binding domain of PheRS 0.0014
Further Details:      
 
Domain Number 5 Region: 426-497
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.37e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483922|ref|YP_005392835.1|
Sequence length 818
Comment phenylalanyl-tRNA synthetase subunit beta [Rickettsia parkeri str. Portsmouth]
Sequence
MKFTLSWLKQFLETSASVTEIAEALTAIGLEVEEVIDKAAELQKFEVAYITNIKPHPSAD
KLKLCDVETKSGMLQIVCGARNARAGIKVVLANIGIEIPNGKFKIKESVIRGEKSCGMLC
SEEELLLASESEGIIELSEDAVVGENFTKYYGLDDPIFVINVTPNRGDALGVYGIARDLA
AKGIGILKELEISAIKSTFISKMKLNVQDKEACPLFTFREIRNLKNKPSPDWLRKLLKNV
GVKTISSLVDVTNYISYSFGQPMHAYDADRIKGGITVARHCEKHNDEAISGQQNEIATAA
LQPRNDVAKCHALNGKEYLLTENDLVIKDESGIQGLAGVIGEADSSCTDSTTNIILEAAC
FNAKMVAASGRRFQIDTDARYRNERNIDRNFTEKALDIATNLILSICGNGEVSEVVKVGE
KESQKKTLDFSACYLEKITGIKLNIKAIEAILNKLGFITDVKGEIIKVIAPSWRHDITIL
EDIAEEIARIYGYDKIESIKLPELDQDNNKLREHKRISSFKRILASKGYDEVVTNSFMSS
EDAKLFAELKEELFLLNPISIGDNYMRPTILPNLLSIVSKNLARSIKDMAFFEVGPSFID
LNTEATYLTAIISGSYNNKNPHSLGRGYDVFDLKGDLELVADYAGLSIDKCIATNGTALP
QYYHPTRAVNIGLGKNLLGHFGQIHPKILKYYDINQEIFAFELNITNLPLIKAKFGKRDE
FAVSDFQANFRDYAFIVGQDHRVGEIISYINNFNKKLIKSVILFDIYSGDKLPEGKKSIA
VKIELQADDRTLSDTDLNSFSKDLVAAISQKFQGTLRE
Download sequence
Identical sequences A0A0F3QP59
WP_014410666.1.24793 WP_014410666.1.3533 WP_014410666.1.42246 WP_014410666.1.49683 gi|383483922|ref|YP_005392835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]