SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483984|ref|YP_005392897.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483984|ref|YP_005392897.1|
Domain Number 1 Region: 87-466,497-568
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 6.1e-134
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000328
Further Details:      
 
Domain Number 2 Region: 12-84
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000000000011
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383483984|ref|YP_005392897.1|
Sequence length 607
Comment ribonucleotide-diphosphate reductase subunit alpha [Rickettsia parkeri str. Portsmouth]
Sequence
MNTFKKNKFQITINNNHNNLLTPFGKAILRDRYLMKGEDFQDLFARVSSYYAENKQHAQK
LYEYMSKMWFMPATPILSNGGTDRGLPISCFLNETDDSLDDIVNLWTENVWLAARGGGIG
SYWGNVRAINEGIRDKGHSSGIIPFIKVMDSMTLAISQGSIRRGSSAVYLPINHPEIEEF
IDIRRPTGGDVNRKALNIHHGIAITDEFMKAVENNTDFDLVSPATKKVVNKVRARDLWVK
LLTTRIETGEPYLLFIDSVNKSIPEHHKKLGLQVKMSNLCSEITLPTGIDHLGKSRTAVC
CLSSLNLEYYEEWKDDKEFIHSIMLFLDKVLEDFINKAPDTMARAKYSALRERSVGLGVM
GFHSFLQMKKVPIESVMAKVWNKKIFEYISAETDKASIEIGKEKGACPDALDAGSNERFS
NKTAIAPTASISVIAGNASPGIEPFAANSFVQKTLTGSFNVRNKHLEKLLEEKGFNNDQV
WSSIATHEGSVQHLTFLSEEEKQVFKTAYEIDQNWLIELASDRTPYITQAQSLNIFLPGN
VSKKYLNNIHFKAWTKGVKSLYYCRSTSIQRADKVSHDVLKADFKDLEEQNDKLAEAGNY
EECLACQ
Download sequence
Identical sequences A0A0F3QT39
WP_014410716.1.24793 WP_014410716.1.3533 WP_014410716.1.42246 WP_014410716.1.49683 gi|383483984|ref|YP_005392897.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]