SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483990|ref|YP_005392903.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483990|ref|YP_005392903.1|
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.61e-35
Family Phosphoglucomutase, first 3 domains 0.0000593
Further Details:      
 
Domain Number 2 Region: 261-367
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.98e-33
Family Phosphoglucomutase, first 3 domains 0.0000298
Further Details:      
 
Domain Number 3 Region: 158-258
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.45e-27
Family Phosphoglucomutase, first 3 domains 0.0000614
Further Details:      
 
Domain Number 4 Region: 370-455
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 7.32e-20
Family Phosphoglucomutase, C-terminal domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483990|ref|YP_005392903.1|
Sequence length 462
Comment phosphomannomutase [Rickettsia parkeri str. Portsmouth]
Sequence
MQINKEIFRAYDIRGNSLKDLTEEVAYKIGFGFAEMTITKDNDKICVGLDGRLSSPTLCK
ALELGLTNAGAEIINIGVVPTPVLYFADKHFTPAGSIMVTGSHNPRDDNGFKILQNGKPF
FGDQIQELLTKILDNYSNTTPASPYVIPAKAGIHNIQSKYLKRILDGININPKLKVAWDC
GNGATGDIVEELKKHLSNKNIIIHSKIDGNFPSHHPDPTNPANLQELIKVVKEQDCDLGI
AFDGDGDRIGIISSSGKILLGDQILCIFAEDILKENPNATIIVDVKVSQFIVAKIKSYGG
HPIIWRTGHPFIKSKMLETKALLAGEMSGHIFFADKYFGFDDAIYAALRFLDLLSRSSKT
LDEIIEDVPKSYSTPEIKIFVPSELKLQIIKEIKEKSLEEKIEFNDIDGVRVNTAHGWWL
LRSSNTESIIVARAESDSKNGLEEIITIINKYLEKYGLLINY
Download sequence
Identical sequences A0A0F3QMZ6
WP_014410721.1.24793 WP_014410721.1.29763 WP_014410721.1.3533 WP_014410721.1.42246 WP_014410721.1.49683 gi|383483990|ref|YP_005392903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]