SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383483996|ref|YP_005392909.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383483996|ref|YP_005392909.1|
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-44
Family Ribonuclease PH domain 1-like 0.0000805
Further Details:      
 
Domain Number 2 Region: 300-469
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-43
Family Ribonuclease PH domain 1-like 0.0000261
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-27
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 149-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-24
Family Ribonuclease PH domain 2-like 0.0033
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 6 Region: 621-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.69e-18
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000199
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383483996|ref|YP_005392909.1|
Sequence length 748
Comment polynucleotide phosphorylase/polyadenylase [Rickettsia parkeri str. Portsmouth]
Sequence
MFNEITKSVTWNGQVLELSTGKIARQADGAVTVKMGNSVLLCTAVVANKAKEGIGFLPLT
INYREMAYAAGKIPGGFFKHEGKASDREVLVSRLIDRPIRPLFHPAFVNETHVTCSVLSY
DPETPVDILAIIGASAALSLSPAPYLEIVAASKVGLINGEFVLNPTLALLKTSQLDLVVA
GTSDSVMMVESEAHLLSEEQMLEAVKFGFESFQPVIKIIKELAEEAKKTKLEMQALYPAS
LKKEIEKLFVKEIEQAFAIKSKQERSTNLDLISEKVLTHFVSDIENKKYSNYQIESALKA
IESDILRNEILEKNRRIDGRSTTDIRQIACEIGLLPSAHGSALFTRGETQSLVSTTFGTS
LDEQIVDSLEGEYKERFMLNYIFPPYSVNEAMPMKAPSRREVGHGKLAWRAINPILPNKV
QFPYSIRVVAETTESNGSSSMATVCGSSLALMYAGVPIKAPVAGIAMGLVKEGKNFAVLS
DILSDEDYFGDMDFKVAGTSEGITALQMDIKISGVDFKIMKVALEQARLGRLHILEQMNK
VISKPNNELSKNAPSTTTIKIDKDKIRDIIGPGGKVIKEICETSGAKIDISDDGTVSVYA
SDRDKLKVALDKIKAIVVEPEIGEIFNGTVVKVLDSGAFINYVGNKDGFVHISEVSGERI
ETVSSVLKQGDIVKVKLIGFDNKGKAKLTIKNADKDKSSNNTKPKTNVNNTKDNSEPEQR
RDSSKKRAWNEDNNAETAEVITERKYFN
Download sequence
Identical sequences A0A0F3QNV0
gi|383483996|ref|YP_005392909.1| WP_014410723.1.24793 WP_014410723.1.3533 WP_014410723.1.42246 WP_014410723.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]