SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484001|ref|YP_005392914.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484001|ref|YP_005392914.1|
Domain Number 1 Region: 8-84
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 6.7e-19
Family SinR domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484001|ref|YP_005392914.1|
Sequence length 125
Comment Putative transcriptional regulator [Rickettsia parkeri str. Portsmouth]
Sequence
MGRKNDIIQKIDSFIGKKIYSLRLAKGLSRQQLAEVIDVTHQQLQKYEKAINRISVGRLV
LIAEALDRNIDYFFEGLEEANKPQPVHTQHQRMCIEVSRNFMKINSTEEQQAVNNLVKCL
AGKKN
Download sequence
Identical sequences A0A0F3QNJ5 A0A0H3AXI1 A0A161QP15 B0BXR5 C3PNK7 C4K0E9 H8LPX4 Q92HV3
gi|383751315|ref|YP_005426416.1| gi|238650247|ref|YP_002916098.1| gi|383484001|ref|YP_005392914.1| gi|379017847|ref|YP_005294082.1| gi|379018997|ref|YP_005295231.1| gi|374319335|ref|YP_005065834.1| 272944.RC0668 347255.RAF_ORF0613 392021.A1G_03795 452659.RrIowa_0798 562019.RPR_00255 gi|157828542|ref|YP_001494784.1| WP_010977292.1.17801 WP_010977292.1.22172 WP_010977292.1.23845 WP_010977292.1.24793 WP_010977292.1.29537 WP_010977292.1.29763 WP_010977292.1.31136 WP_010977292.1.33163 WP_010977292.1.3339 WP_010977292.1.3533 WP_010977292.1.38731 WP_010977292.1.41615 WP_010977292.1.42246 WP_010977292.1.4490 WP_010977292.1.49683 WP_010977292.1.54113 WP_010977292.1.54264 WP_010977292.1.55704 WP_010977292.1.74071 WP_010977292.1.76853 WP_010977292.1.77680 WP_010977292.1.78650 WP_010977292.1.81845 WP_010977292.1.83836 WP_010977292.1.89241 WP_010977292.1.93503 gi|378721356|ref|YP_005286243.1| gi|378722703|ref|YP_005287589.1| gi|165933258|ref|YP_001650047.1| gi|229586759|ref|YP_002845260.1| gi|379016384|ref|YP_005292619.1| gi|378724060|ref|YP_005288944.1| gi|15892591|ref|NP_360305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]