SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484011|ref|YP_005392924.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484011|ref|YP_005392924.1|
Domain Number 1 Region: 70-216
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000369
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484011|ref|YP_005392924.1|
Sequence length 222
Comment glutathione S-transferase [Rickettsia parkeri str. Portsmouth]
Sequence
MKKLYHNPICPLSRQARVFLKELDIEFTTIKEDYWQFNKDFLKINPAGTLPILAESYGLF
VVGIYPFVEYLNSKYPNFNFLDEDIDICCEIRRLFFWFNDKFYREVTKIIIDEKVIRSIA
KMSSPRTEFLRVAKNNLNYHLEYITSLLEKRSYLVSESLTIADIAASCHLSVLDYFGEIY
WDKWTLIKHWYSLIKSRPAFRLLLQDRIPGFTPPNYYTDLDF
Download sequence
Identical sequences A0A0F3QMB5 H8LPY6 Q92HI9
272944.RC0782 gi|374319347|ref|YP_005065846.1| gi|15892705|ref|NP_360419.1| gi|383751327|ref|YP_005426428.1| gi|383484011|ref|YP_005392924.1| WP_010977394.1.23845 WP_010977394.1.24793 WP_010977394.1.29763 WP_010977394.1.33163 WP_010977394.1.3533 WP_010977394.1.42246 WP_010977394.1.49683 WP_010977394.1.54264 WP_010977394.1.55704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]