SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484028|ref|YP_005392941.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484028|ref|YP_005392941.1|
Domain Number 1 Region: 120-403
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.9e-68
Family RecA protein-like (ATPase-domain) 0.000000025
Further Details:      
 
Domain Number 2 Region: 79-154
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.43e-29
Family Cold shock DNA-binding domain-like 0.0000461
Further Details:      
 
Domain Number 3 Region: 31-75
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000000271
Family Rho termination factor, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484028|ref|YP_005392941.1|
Sequence length 458
Comment transcription termination factor Rho [Rickettsia parkeri str. Portsmouth]
Sequence
MNTTNKESTAELNNTESNNNYNNFAENGNIINLKQLKRKLPEELQAQAEELKIENINSLL
KQELVFAILKKSVEQGVLIVGEGVLEVLPDGFGFLRSPEVNYLAGPDDIYISPSQIRRFG
LRTGDTVEGQIRAPKAGERYFALLKVNRVNFEDPSKAYHRVHFDNLTPLYPDEKLGLELE
NNSKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIVLL
IDERPEEVTDMQRSVRGEVVSSTFDEPASRHVQLAEMVIKKAKRLVEHKKDVVILVDAIT
RLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIENGGSLTIIGTALIETGSRMD
EVIFEEFKGTGNSEIVLDRKIADKRIYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIID
PMGSSEAIEFLLKKLENTKTNGEFFEMMKSPERPKNGL
Download sequence
Identical sequences A0A0F3QS66 A0A0H3AUV7 B0BXU2 C3PNN5 H6PTY1 H8LQ04 Q7P8M3 Q92HL2
gi|157828571|ref|YP_001494813.1| gi|379017872|ref|YP_005294107.1| 272944.RC0759 347255.RAF_ORF0645 392021.A1G_03955 452659.RrIowa_0830 gi|378724086|ref|YP_005288970.1| gi|229586787|ref|YP_002845288.1| gi|379018971|ref|YP_005295205.1| gi|379016358|ref|YP_005292593.1| gi|383484028|ref|YP_005392941.1| gi|378722729|ref|YP_005287615.1| WP_004998383.1.16657 WP_004998383.1.17801 WP_004998383.1.22823 WP_004998383.1.23845 WP_004998383.1.24793 WP_004998383.1.29537 WP_004998383.1.29763 WP_004998383.1.31136 WP_004998383.1.33163 WP_004998383.1.3339 WP_004998383.1.3533 WP_004998383.1.38731 WP_004998383.1.42246 WP_004998383.1.4490 WP_004998383.1.47675 WP_004998383.1.49683 WP_004998383.1.54264 WP_004998383.1.55704 WP_004998383.1.74071 WP_004998383.1.76853 WP_004998383.1.77680 WP_004998383.1.78650 WP_004998383.1.81845 WP_004998383.1.83836 WP_004998383.1.89241 WP_004998383.1.95812 gi|378721383|ref|YP_005286270.1| gi|374319364|ref|YP_005065863.1| gi|165933285|ref|YP_001650074.1| gi|15892682|ref|NP_360396.1| gi|379712446|ref|YP_005300785.1| gi|383751345|ref|YP_005426446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]