SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484067|ref|YP_005392980.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484067|ref|YP_005392980.1|
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.57e-30
Family Transcriptional regulator Rrf2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383484067|ref|YP_005392980.1|
Sequence length 139
Comment Rrf2 family protein [Rickettsia parkeri str. Portsmouth]
Sequence
MMLTTKGRYAVMAILEMASKSSAEPVTLNEMSVKQNISLNYLEQIFSKLKKADLVKAIRG
SKGGYILIGNLEEIKISDIMDAVNENFIMTTCYKKSVKTCVPDTIKCNSHKLWQGLGKHI
RDYFENISIKDALNSNLNI
Download sequence
Identical sequences A0A0F3QN56 A0A0F3RCN4 A0A0H3AYE9 A0A162VC35 B0BXX8 C3PNQ6 C4K1Z9 G0GYI4 H6PU16 H8LMJ2
gi|157828607|ref|YP_001494849.1| gi|238650793|ref|YP_002916648.1| gi|383484067|ref|YP_005392980.1| gi|379016321|ref|YP_005292556.1| gi|383751368|ref|YP_005426469.1| gi|341583979|ref|YP_004764470.1| gi|165933321|ref|YP_001650110.1| gi|379712481|ref|YP_005300820.1| gi|378721420|ref|YP_005286307.1| 347255.RAF_ORF0674 392021.A1G_04135 452659.RrIowa_0870 562019.RPR_04690 gi|229586808|ref|YP_002845309.1| WP_012150915.1.16657 WP_012150915.1.17801 WP_012150915.1.22823 WP_012150915.1.24793 WP_012150915.1.29537 WP_012150915.1.31136 WP_012150915.1.3339 WP_012150915.1.3533 WP_012150915.1.36380 WP_012150915.1.38731 WP_012150915.1.41615 WP_012150915.1.42246 WP_012150915.1.4490 WP_012150915.1.47675 WP_012150915.1.49683 WP_012150915.1.54113 WP_012150915.1.54264 WP_012150915.1.55704 WP_012150915.1.68899 WP_012150915.1.74071 WP_012150915.1.76853 WP_012150915.1.77680 WP_012150915.1.78650 WP_012150915.1.81845 WP_012150915.1.83836 WP_012150915.1.89241 WP_012150915.1.93503 WP_012150915.1.95812 gi|379018943|ref|YP_005295177.1| gi|378722767|ref|YP_005287653.1| gi|379017910|ref|YP_005294145.1| gi|378724124|ref|YP_005289008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]