SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484106|ref|YP_005393019.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484106|ref|YP_005393019.1|
Domain Number 1 Region: 1-315
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.99e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000255
Further Details:      
 
Domain Number 2 Region: 336-458
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.19e-43
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383484106|ref|YP_005393019.1|
Sequence length 459
Comment dihydrolipoamide dehydrogenase [Rickettsia parkeri str. Portsmouth]
Sequence
MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKSDTLGGTCLNIGCIPSKVLLNSSEKY
EAALKHFENIGIIADVKLDLQKMLANKDKVVLDLTQGIESLFAKNKVTRIKGEAKISSSN
IVEVNKEQIKAKNILITTGSSIIEIPNIKIDEEFIVSSTGALKLSKVPENLIVVGGGYIG
LELGSVWRRLGAKVTVIEYAPSIVPMLDKEIATQFMKLQQKQGIEFKLNTKVLSAEVKSG
KVNLTIEEDGKSSVVTSDVVLMAVGRKAYTQNLGLESVGIITDKQGSIEINDRFQTAISN
IYAVGDVVKGAMLAHKAEEEAVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQL
KEKGINYKVGKFPFLANSRARAIGSTEGMVKILADSKTDRVLGAHIIGADAGTLIAALTA
YMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRTINM
Download sequence
Identical sequences A0A0F3QNT9 C3PNT8
WP_012719796.1.24793 WP_012719796.1.29537 WP_012719796.1.3533 WP_012719796.1.42246 WP_012719796.1.49683 gi|383484106|ref|YP_005393019.1| gi|229586840|ref|YP_002845341.1| 347255.RAF_ORF0708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]