SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484145|ref|YP_005393058.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484145|ref|YP_005393058.1|
Domain Number 1 Region: 61-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.25e-47
Family RecA protein-like (ATPase-domain) 0.0093
Further Details:      
 
Domain Number 2 Region: 248-262,296-421
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.56e-30
Family ATP-dependent protease Lon (La), catalytic domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383484145|ref|YP_005393058.1|
Sequence length 444
Comment DNA repair protein RadA [Rickettsia parkeri str. Portsmouth]
Sequence
MTKKHYICSNCGNISPKWSGQCFDCGVWGSIVEEIISTNQAIVKVGSKQDFDKLSGHVTE
QLRIPTPIGEFNRVLGGGLVLGSAILIGGDPGIGKSTLLLQLAASNFASKINCLYITGEE
SLDQIKLRAIRLNLTNYNTDILAATNLEDIIASTEANKNNIDLIVIDSIQTITTKELSSP
PGTVSQIRTCANELVNYAKQNNIIILLSCHVTKDGQLAGPKILEHLVDTVLYFEGDHNNH
FRILRSYKNRFGGVGEIGVFEMSGSGLIEVTNPSELFLMQREQNVIGTSIFAGIEGSRPL
LMEVQALIVPSNMVTPRRSAVGWDANRLSMILAVLSSRIGLNLANYEVYLSIAGGLKIAD
PASDLAVTASLISAATGNPVPEHSVFFGEISLSGEIRKTAKAETRIKEAIKLGFNKIICS
KFENLTYDFISSVSHLKDLKEIIK
Download sequence
Identical sequences A0A0F3QPB4
WP_014410826.1.24793 WP_014410826.1.3533 WP_014410826.1.42246 WP_014410826.1.49683 gi|383484145|ref|YP_005393058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]