SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484170|ref|YP_005393083.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484170|ref|YP_005393083.1|
Domain Number 1 Region: 39-112
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 0.000000000315
Family HCDH C-domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383484170|ref|YP_005393083.1|
Sequence length 122
Comment 3-hydroxyacyl-CoA dehydrogenase (FadB) [Rickettsia parkeri str. Portsmouth]
Sequence
MELLELIIDPMIKAEVIERVSEFLTKTLGKIIVKCNDTPGFIANRVGYFLLELVARKAIS
QNLDVATIDKIFTTFLGLPSTGIFGLYDLIGYDVMKLISSSLLASLPANDAYHKIICKDP
CS
Download sequence
Identical sequences A0A0F3QQ75
gi|383484170|ref|YP_005393083.1| WP_014410844.1.24793 WP_014410844.1.3533 WP_014410844.1.42246 WP_014410844.1.49683 WP_014410844.1.54264 WP_014410844.1.93503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]