SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484225|ref|YP_005393138.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484225|ref|YP_005393138.1|
Domain Number 1 Region: 49-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 2e-51
Family Glutathione peroxidase-like 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383484225|ref|YP_005393138.1|
Sequence length 205
Comment Sco2 protein [Rickettsia parkeri str. Portsmouth]
Sequence
MKIQSNVIKIIIVISLLIGVGALYLLLSLRTPEKPLAGQVNIYEDNVKIGGDFELIDQNG
EIFNSDKLKGNLSLIYFGFTSCPDICPTSLNKMTEIVEILNKHKIDILPVFITIDPKRDT
PIALKEYLKHFHPKFIGLTGNEQQIKDVTDKFKVFYARVHGDDDDPNYMLDHSSFTYLID
ANGKYLKHFYLDSSPKEMMEFLRNE
Download sequence
Identical sequences A0A0F3QN05 Q7P930 Q92H76
WP_004998018.1.23845 WP_004998018.1.24793 WP_004998018.1.33163 WP_004998018.1.3533 WP_004998018.1.42246 WP_004998018.1.47675 WP_004998018.1.49683 WP_004998018.1.95812 gi|15892818|ref|NP_360532.1| 272944.RC0895 gi|383484225|ref|YP_005393138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]