SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484236|ref|YP_005393149.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484236|ref|YP_005393149.1|
Domain Number 1 Region: 377-385
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000128
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  gi|383484236|ref|YP_005393149.1|
Domain Number - Region: 97-211
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.00641
Family Typo IV secretion system protein TraC 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383484236|ref|YP_005393149.1|
Sequence length 526
Comment Actin polymerization protein RickA [Rickettsia parkeri str. Portsmouth]
Sequence
MVKEIDINKLLAQENNALNTILSQVNELCKQNKQLQGLIEIQNETKQLEKEHNRSLPWFK
RFVKTVSNVKYILIKSEEQLTNEAIKYNNKILKDIDNKIYNIAEKSAPLKQALQEEIEKN
FKDLTKKDLSKDQRARLSEVFFSYKSKPERFSSLHMTNPLQFINAEALEKQYNSLNATKQ
NIQNLISENSNIKELKEIQKQVAEIRAEVPHTFFEKLNNIWQNVKNVFVNNSEQVLAKNK
ESNTRTIRKIDEQLYKTKHKFEELIENKERNIKDIIAKLPDNEKLQKIVSNLTNHMASQK
EPILANASLAKPLENNITPPSPLPENNTPSPPPPPLPENNTPSPPPPPLPENNTPSPPPP
PPPPPLPENNTPSPPPPPPPPPPPPPPMAPAKTLSKPVESTTVKKLENQPSPSIDTFDLM
RELAGPKKLKKVEFDPNTGKPVAHPHSKPAQNVNKPSGLESIFARRVAIEVSDSSSSESD
SGNWSDVSVNRNKSKILKTKGERDAKMTTHAQKINNRNSQKPSFVR
Download sequence
Identical sequences gi|383484236|ref|YP_005393149.1| WP_014410895.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]