SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383484238|ref|YP_005393151.1| from Rickettsia parkeri str. Portsmouth

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383484238|ref|YP_005393151.1|
Domain Number 1 Region: 99-312
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.79e-43
Family MurCDEF 0.00014
Further Details:      
 
Domain Number 2 Region: 314-447
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 6.41e-32
Family MurCDEF C-terminal domain 0.002
Further Details:      
 
Domain Number 3 Region: 5-95
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 1.22e-18
Family MurE/MurF N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383484238|ref|YP_005393151.1|
Sequence length 449
Comment UDP-N-acetylmuramoylalanyl-D-glutamyl- 2,6-diaminopimelate--D-alanyl-D-alanyl ligase [Rickettsia parkeri str. Portsmouth]
Sequence
MIWNSKTLSAVLGITISNSISCNEVQFNSKDVKKGNLFIALQGNRDGHDYVLDAIDKGAA
AVIISKRVEINDKDKIILVDDCFEALQKMALYKRENSKAKFIAITGSVGKTSTKEALKVL
LQHDFLVFASRGNFNNKLGMLINLASMADDTEYAIFELGMNHKGEIRELVQILKPNIAMI
TNISEAHLEFFNSLEEIAEAKCEIFANFSKNDIAVINADTNCYNKILSILTNLSITDIHS
FGRSAKTSAELILYENLGEQVYLKYKINKKVLDVTIPFIPRHFTENYTGVLLIIDILGKD
IEIAANHLANISPTKGRGEIINIQNCRVICDYYNASPQSMKAALEYLKQVPAENKTAIIG
DMLELGENSKRLHEKLVQYILDAACSKVYLVGVNTKYINDLLPSKIAKKYFKNVDELITH
ITDLFEGNELILIKGSRGVKLDKIVDYYK
Download sequence
Identical sequences A0A0F3QMC9
WP_014410897.1.24793 WP_014410897.1.3533 WP_014410897.1.42246 WP_014410897.1.49683 gi|383484238|ref|YP_005393151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]